BLASTX nr result
ID: Cephaelis21_contig00015946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00015946 (396 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAL32668.1| putative preprotein translocase SECY protein [Ara... 62 6e-08 ref|XP_002879332.1| hypothetical protein ARALYDRAFT_320901 [Arab... 61 1e-07 gb|AAD24832.1| putative preprotein translocase SECY protein [Ara... 60 1e-07 gb|AFW77908.1| hypothetical protein ZEAMMB73_730962 [Zea mays] 57 2e-06 ref|XP_003520565.1| PREDICTED: preprotein translocase subunit se... 56 3e-06 >gb|AAL32668.1| putative preprotein translocase SECY protein [Arabidopsis thaliana] gi|20260012|gb|AAM13353.1| putative preprotein translocase SECY protein [Arabidopsis thaliana] Length = 253 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +1 Query: 1 VLCHMVPSLVKLRKEGLDGHEKIKSYMCV 87 VLCH++PSLVKLRKEGLDGHEKIKSYMCV Sbjct: 225 VLCHVLPSLVKLRKEGLDGHEKIKSYMCV 253 >ref|XP_002879332.1| hypothetical protein ARALYDRAFT_320901 [Arabidopsis lyrata subsp. lyrata] gi|297325171|gb|EFH55591.1| hypothetical protein ARALYDRAFT_320901 [Arabidopsis lyrata subsp. lyrata] Length = 567 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 1 VLCHMVPSLVKLRKEGLDGHEKIKSYMCV*FFIS 102 VLCH++PSLVKLRKEGLDGHEKIKSYMC+ +S Sbjct: 218 VLCHVLPSLVKLRKEGLDGHEKIKSYMCMVAIVS 251 >gb|AAD24832.1| putative preprotein translocase SECY protein [Arabidopsis thaliana] Length = 556 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +1 Query: 1 VLCHMVPSLVKLRKEGLDGHEKIKSYMCV 87 VLCH++PSLVKLRKEGLDGHEKIKSYMC+ Sbjct: 207 VLCHVLPSLVKLRKEGLDGHEKIKSYMCM 235 >gb|AFW77908.1| hypothetical protein ZEAMMB73_730962 [Zea mays] Length = 201 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +1 Query: 1 VLCHMVPSLVKLRKEGLDGHEKIKSYMCV 87 VLCH++PSL KLRKEGLDGHEK+K YMCV Sbjct: 173 VLCHVLPSLEKLRKEGLDGHEKLKGYMCV 201 >ref|XP_003520565.1| PREDICTED: preprotein translocase subunit secY-like [Glycine max] Length = 546 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +1 Query: 1 VLCHMVPSLVKLRKEGLDGHEKIKSYM 81 VLCH+VPSLVKLRKEGLDGHEKIKSY+ Sbjct: 214 VLCHVVPSLVKLRKEGLDGHEKIKSYI 240