BLASTX nr result
ID: Cephaelis21_contig00015943
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00015943 (357 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523356.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 gb|ACJ02346.1| ubiquitin family protein [Vernicia fordii] 56 3e-06 >ref|XP_002523356.1| conserved hypothetical protein [Ricinus communis] gi|223537444|gb|EEF39072.1| conserved hypothetical protein [Ricinus communis] Length = 441 Score = 55.8 bits (133), Expect = 3e-06 Identities = 38/98 (38%), Positives = 52/98 (53%) Frame = +2 Query: 17 EANGPESKRLKIWLGKRILGXXXXXXXXXXXXXXXNNRSVVLDNEDHSSLSEEAKGSSDS 196 +A G ++KRLKIW+GKR LG N +S VL+ ++S +S+EA GSSDS Sbjct: 198 KAVGLDAKRLKIWMGKRTLGDSDSEDNSDDEE---NEKSAVLNIGNNSDISKEADGSSDS 254 Query: 197 VTEARCDMISSDSGAPGSVSEEEKAFVEESRELDGSRN 310 VT + + S + S SEEEK + L S N Sbjct: 255 VTGGKQEGDCSGGASCESGSEEEKDAATAEQTLQFSSN 292 >gb|ACJ02346.1| ubiquitin family protein [Vernicia fordii] Length = 370 Score = 55.8 bits (133), Expect = 3e-06 Identities = 36/90 (40%), Positives = 49/90 (54%), Gaps = 1/90 (1%) Frame = +2 Query: 2 RKDSGEANGPESKRLKIWLGKRILGXXXXXXXXXXXXXXXNN-RSVVLDNEDHSSLSEEA 178 RK G ++KR+KIW+GKR LG N +SVVL++ +HS L++EA Sbjct: 106 RKGKVPKEGLDAKRVKIWMGKRKLGESDSEDMDEDSSDDEENEKSVVLNSGNHSDLNKEA 165 Query: 179 KGSSDSVTEARCDMISSDSGAPGSVSEEEK 268 +GSSDSVT + D S + SE EK Sbjct: 166 EGSSDSVTGGKQDGECSGGASCECGSEGEK 195