BLASTX nr result
ID: Cephaelis21_contig00015860
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00015860 (485 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002325490.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 emb|CBI27769.3| unnamed protein product [Vitis vinifera] 55 6e-06 ref|XP_002277600.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 55 6e-06 >ref|XP_002325490.1| predicted protein [Populus trichocarpa] gi|222862365|gb|EEE99871.1| predicted protein [Populus trichocarpa] Length = 594 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = +2 Query: 359 LNFGKTLCSSDEEYKLPAQLSQSYVQVPCGSRLVVLLSILKD 484 L + K SS +YKLPAQL Q YV+VPCGSRL VLLSILK+ Sbjct: 276 LGYSKVKNSSTGDYKLPAQLVQRYVKVPCGSRLAVLLSILKN 317 >emb|CBI27769.3| unnamed protein product [Vitis vinifera] Length = 584 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +2 Query: 371 KTLCSSDEEYKLPAQLSQSYVQVPCGSRLVVLLSILK 481 K + S+ +YKLPAQL Q YV+VPCGSRLVVLLSILK Sbjct: 272 KIISPSNGDYKLPAQLVQRYVKVPCGSRLVVLLSILK 308 >ref|XP_002277600.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 17-like [Vitis vinifera] Length = 600 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +2 Query: 371 KTLCSSDEEYKLPAQLSQSYVQVPCGSRLVVLLSILK 481 K + S+ +YKLPAQL Q YV+VPCGSRLVVLLSILK Sbjct: 288 KIISPSNGDYKLPAQLVQRYVKVPCGSRLVVLLSILK 324