BLASTX nr result
ID: Cephaelis21_contig00015614
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00015614 (281 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310123.1| predicted protein [Populus trichocarpa] gi|2... 72 6e-11 ref|XP_002865017.1| nitrogen regulation family protein [Arabidop... 71 8e-11 ref|NP_201523.1| tRNA-dihydrouridine synthase 4 [Arabidopsis tha... 71 8e-11 emb|CBI21377.3| unnamed protein product [Vitis vinifera] 65 4e-09 ref|XP_002283225.1| PREDICTED: tRNA-dihydrouridine synthase 1-li... 65 4e-09 >ref|XP_002310123.1| predicted protein [Populus trichocarpa] gi|222853026|gb|EEE90573.1| predicted protein [Populus trichocarpa] Length = 358 Score = 71.6 bits (174), Expect = 6e-11 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 2/60 (3%) Frame = +3 Query: 108 DDDRLCI--EQKELRIEEPPEESLAVGHPNGYLSGESRIERAWAHWKKIGRPKFIVAPMV 281 +DD C +Q++ E E+ +G P GYLSGE+R+ERAW HW K+GRPK IVAPMV Sbjct: 33 NDDSPCSNPQQQQTETHENSSETALLGEPRGYLSGEARVERAWGHWSKLGRPKLIVAPMV 92 >ref|XP_002865017.1| nitrogen regulation family protein [Arabidopsis lyrata subsp. lyrata] gi|297310852|gb|EFH41276.1| nitrogen regulation family protein [Arabidopsis lyrata subsp. lyrata] Length = 423 Score = 71.2 bits (173), Expect = 8e-11 Identities = 34/58 (58%), Positives = 45/58 (77%), Gaps = 1/58 (1%) Frame = +3 Query: 111 DDRLCIEQKELRIEEPPEESLA-VGHPNGYLSGESRIERAWAHWKKIGRPKFIVAPMV 281 DD LC EQ++ +IEE + A +G P+ LS ++R+ERAWAHWKK+GRPK+IVAPMV Sbjct: 39 DDLLCSEQRDGQIEETVDAVAASLGSPSRVLSIDTRVERAWAHWKKLGRPKYIVAPMV 96 >ref|NP_201523.1| tRNA-dihydrouridine synthase 4 [Arabidopsis thaliana] gi|10177609|dbj|BAB10956.1| unnamed protein product [Arabidopsis thaliana] gi|15146316|gb|AAK83641.1| AT5g67220/K21H1_18 [Arabidopsis thaliana] gi|20908082|gb|AAM26724.1| AT5g67220/K21H1_18 [Arabidopsis thaliana] gi|332010932|gb|AED98315.1| tRNA-dihydrouridine synthase 4 [Arabidopsis thaliana] Length = 423 Score = 71.2 bits (173), Expect = 8e-11 Identities = 34/58 (58%), Positives = 46/58 (79%), Gaps = 1/58 (1%) Frame = +3 Query: 111 DDRLCIEQKELRIEEPPEESLA-VGHPNGYLSGESRIERAWAHWKKIGRPKFIVAPMV 281 DD LC EQ++ +IEE + + A +G P+ LS ++R+ERAWAHWKK+GRPK+IVAPMV Sbjct: 39 DDILCSEQRDGQIEETVDTAPASLGSPSRVLSIDTRVERAWAHWKKLGRPKYIVAPMV 96 >emb|CBI21377.3| unnamed protein product [Vitis vinifera] Length = 316 Score = 65.5 bits (158), Expect = 4e-09 Identities = 32/57 (56%), Positives = 40/57 (70%) Frame = +3 Query: 111 DDRLCIEQKELRIEEPPEESLAVGHPNGYLSGESRIERAWAHWKKIGRPKFIVAPMV 281 DD +C EQ+E +S + P+ L+GESRIERAWAHWKK+G+PK IVAPMV Sbjct: 24 DDHICSEQQE----HQECQSSSADWPSRCLTGESRIERAWAHWKKLGQPKLIVAPMV 76 >ref|XP_002283225.1| PREDICTED: tRNA-dihydrouridine synthase 1-like [Vitis vinifera] Length = 424 Score = 65.5 bits (158), Expect = 4e-09 Identities = 32/57 (56%), Positives = 40/57 (70%) Frame = +3 Query: 111 DDRLCIEQKELRIEEPPEESLAVGHPNGYLSGESRIERAWAHWKKIGRPKFIVAPMV 281 DD +C EQ+E +S + P+ L+GESRIERAWAHWKK+G+PK IVAPMV Sbjct: 48 DDHICSEQQE----HQECQSSSADWPSRCLTGESRIERAWAHWKKLGQPKLIVAPMV 100