BLASTX nr result
ID: Cephaelis21_contig00015501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00015501 (758 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526321.1| conserved hypothetical protein [Ricinus comm... 51 6e-07 ref|XP_002515874.1| conserved hypothetical protein [Ricinus comm... 56 7e-06 >ref|XP_002526321.1| conserved hypothetical protein [Ricinus communis] gi|223534348|gb|EEF36057.1| conserved hypothetical protein [Ricinus communis] Length = 225 Score = 51.2 bits (121), Expect(2) = 6e-07 Identities = 33/88 (37%), Positives = 51/88 (57%), Gaps = 10/88 (11%) Frame = -1 Query: 755 LMEINNKYQEKLQWLRAREAGQREKIVQKESEARVHQYHLAG---TG------QSHPNDP 603 + EIN +YQEKL LRA++A +RE+ + +ES R+ QYH AG TG + + +P Sbjct: 111 ISEINTRYQEKLSALRAQQANRREEFLCRESNTRLSQYHQAGMHYTGTTLHDIRGYSGEP 170 Query: 602 -HGYVDTISQARQVNRPDQMNYREQSHF 522 G + + +A N+ D +YR+Q F Sbjct: 171 ASGATEEVHRASATNQFD--SYRDQPLF 196 Score = 28.5 bits (62), Expect(2) = 6e-07 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 498 GCIPYLEGRVYNNDG 454 G IPY EGRVYNN G Sbjct: 207 GRIPYSEGRVYNNAG 221 >ref|XP_002515874.1| conserved hypothetical protein [Ricinus communis] gi|223545029|gb|EEF46543.1| conserved hypothetical protein [Ricinus communis] Length = 274 Score = 56.2 bits (134), Expect = 7e-06 Identities = 33/89 (37%), Positives = 49/89 (55%), Gaps = 11/89 (12%) Frame = -1 Query: 755 LMEINNKYQEKLQWLRAREAGQREKIVQKESEARVHQYHLAGT-----GQSHPNDPHGYV 591 ++ I+ +YQE+L LRAR AG+R++ ++KES AR HQY + T + P DPHGY Sbjct: 158 IIAISTQYQEQLSALRARHAGRRDEFLRKESHARQHQYQQSMTDHFPDSRMGPGDPHGYN 217 Query: 590 DTISQA------RQVNRPDQMNYREQSHF 522 + A R N +Y E++ F Sbjct: 218 GSAPSAVINDNHRAYNTDQFESYGERTRF 246