BLASTX nr result
ID: Cephaelis21_contig00015491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00015491 (950 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270509.2| PREDICTED: cohesin subunit SA-1-like [Vitis ... 79 2e-12 emb|CBI32283.3| unnamed protein product [Vitis vinifera] 79 2e-12 emb|CAN67841.1| hypothetical protein VITISV_016664 [Vitis vinifera] 79 2e-12 ref|XP_002520706.1| stromal antigen, putative [Ricinus communis]... 78 4e-12 ref|XP_004165309.1| PREDICTED: cohesin subunit SA-1-like, partia... 76 1e-11 >ref|XP_002270509.2| PREDICTED: cohesin subunit SA-1-like [Vitis vinifera] Length = 1143 Score = 78.6 bits (192), Expect = 2e-12 Identities = 33/48 (68%), Positives = 41/48 (85%) Frame = -2 Query: 949 LKSVRERVENVNTDEDPSGWRPYYAFVDTLNEKYAKIEDLQDEKEGST 806 LK V++R ENVNTDEDPSGWRPYY F+D+L EKY+K + QDEKEG++ Sbjct: 996 LKDVQKRTENVNTDEDPSGWRPYYTFIDSLREKYSKNDGFQDEKEGTS 1043 Score = 56.6 bits (135), Expect = 8e-06 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -1 Query: 581 PLIQSFRSSAKLRSLKVSKEENRGQIKTGDFNRGAEDLAASRT 453 PLIQS RSSAKLRSL+VS+EEN+G GD R + +AASRT Sbjct: 1096 PLIQSIRSSAKLRSLRVSREENKGPTNPGDSGRATDAIAASRT 1138 >emb|CBI32283.3| unnamed protein product [Vitis vinifera] Length = 1144 Score = 78.6 bits (192), Expect = 2e-12 Identities = 33/48 (68%), Positives = 41/48 (85%) Frame = -2 Query: 949 LKSVRERVENVNTDEDPSGWRPYYAFVDTLNEKYAKIEDLQDEKEGST 806 LK V++R ENVNTDEDPSGWRPYY F+D+L EKY+K + QDEKEG++ Sbjct: 997 LKDVQKRTENVNTDEDPSGWRPYYTFIDSLREKYSKNDGFQDEKEGTS 1044 Score = 56.6 bits (135), Expect = 8e-06 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -1 Query: 581 PLIQSFRSSAKLRSLKVSKEENRGQIKTGDFNRGAEDLAASRT 453 PLIQS RSSAKLRSL+VS+EEN+G GD R + +AASRT Sbjct: 1097 PLIQSIRSSAKLRSLRVSREENKGPTNPGDSGRATDAIAASRT 1139 >emb|CAN67841.1| hypothetical protein VITISV_016664 [Vitis vinifera] Length = 1616 Score = 78.6 bits (192), Expect = 2e-12 Identities = 33/48 (68%), Positives = 41/48 (85%) Frame = -2 Query: 949 LKSVRERVENVNTDEDPSGWRPYYAFVDTLNEKYAKIEDLQDEKEGST 806 LK V++R ENVNTDEDPSGWRPYY F+D+L EKY+K + QDEKEG++ Sbjct: 1388 LKDVQKRTENVNTDEDPSGWRPYYTFIDSLREKYSKNDGFQDEKEGTS 1435 Score = 56.6 bits (135), Expect = 8e-06 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -1 Query: 581 PLIQSFRSSAKLRSLKVSKEENRGQIKTGDFNRGAEDLAASRT 453 PLIQS RSSAKLRSL+VS+EEN+G GD R + +AASRT Sbjct: 1488 PLIQSIRSSAKLRSLRVSREENKGPXNPGDSGRATDAIAASRT 1530 >ref|XP_002520706.1| stromal antigen, putative [Ricinus communis] gi|223540091|gb|EEF41668.1| stromal antigen, putative [Ricinus communis] Length = 1106 Score = 77.8 bits (190), Expect = 4e-12 Identities = 35/47 (74%), Positives = 38/47 (80%) Frame = -2 Query: 949 LKSVRERVENVNTDEDPSGWRPYYAFVDTLNEKYAKIEDLQDEKEGS 809 LK V+ R ENVNTDEDPSGWRPY+ FVD L EKYAK E L DEKEG+ Sbjct: 984 LKDVQSRTENVNTDEDPSGWRPYFTFVDNLREKYAKNEGLPDEKEGT 1030 >ref|XP_004165309.1| PREDICTED: cohesin subunit SA-1-like, partial [Cucumis sativus] Length = 1123 Score = 75.9 bits (185), Expect = 1e-11 Identities = 32/48 (66%), Positives = 40/48 (83%) Frame = -2 Query: 949 LKSVRERVENVNTDEDPSGWRPYYAFVDTLNEKYAKIEDLQDEKEGST 806 +K V+ R N+NTDEDPSGWRPY+ FVD+L EKYAK + LQDEKEG++ Sbjct: 984 IKDVQNRTGNINTDEDPSGWRPYHTFVDSLREKYAKSDGLQDEKEGNS 1031