BLASTX nr result
ID: Cephaelis21_contig00015471
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00015471 (613 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510021.1| conserved hypothetical protein [Ricinus comm... 58 2e-06 >ref|XP_002510021.1| conserved hypothetical protein [Ricinus communis] gi|223550722|gb|EEF52208.1| conserved hypothetical protein [Ricinus communis] Length = 368 Score = 57.8 bits (138), Expect = 2e-06 Identities = 38/106 (35%), Positives = 61/106 (57%), Gaps = 7/106 (6%) Frame = -1 Query: 592 SHQKAALVEKSSKKEVIDQEGPNEYQILKLGRKNLNPRLDDLATDLQKLHDXXXXXXXXX 413 S+ K + S+ K I ++ ++Y+++KLGRK+L+PR+D+ A ++ D Sbjct: 40 SYDKKNAYDNSTGK--ISEQVQSKYEVVKLGRKHLHPRVDETALGIESQLDKAELEEEVE 97 Query: 412 ENKFRDNEEDESGVG-------NQEKTEEGAEHEQLQDLIDEDDSE 296 E K +D E+DE G G +QE+ EE E E+++DLID DD E Sbjct: 98 EIKPQDLEDDERGGGDDEIDGHDQERAEED-ESEEVEDLIDVDDRE 142