BLASTX nr result
ID: Cephaelis21_contig00015320
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00015320 (343 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003613171.1| Lipase [Medicago truncatula] gi|355514506|gb... 59 3e-07 ref|XP_002527906.1| catalytic, putative [Ricinus communis] gi|22... 59 4e-07 gb|AFX67039.1| lipase, partial [Solanum tuberosum] 58 9e-07 ref|XP_004168442.1| PREDICTED: LOW QUALITY PROTEIN: lipase-like ... 56 4e-06 ref|XP_004142969.1| PREDICTED: lipase-like [Cucumis sativus] 56 4e-06 >ref|XP_003613171.1| Lipase [Medicago truncatula] gi|355514506|gb|AES96129.1| Lipase [Medicago truncatula] Length = 465 Score = 59.3 bits (142), Expect = 3e-07 Identities = 33/50 (66%), Positives = 36/50 (72%) Frame = +2 Query: 5 HLAWWWVVRLLQ*MLEDKAFKGYESTSPN*VLSITLLSCLFNGTRRMDFD 154 H A VVR+LQ ML DKAFKGYE+TS N VLS+T LS FNGT R FD Sbjct: 171 HSAGAQVVRVLQQMLADKAFKGYENTSENWVLSLTALSGAFNGTTRTYFD 220 >ref|XP_002527906.1| catalytic, putative [Ricinus communis] gi|223532681|gb|EEF34463.1| catalytic, putative [Ricinus communis] Length = 465 Score = 58.9 bits (141), Expect = 4e-07 Identities = 33/50 (66%), Positives = 36/50 (72%) Frame = +2 Query: 5 HLAWWWVVRLLQ*MLEDKAFKGYESTSPN*VLSITLLSCLFNGTRRMDFD 154 H A VVR+LQ ML DKAFKGYE+TS N VLS+T LS FNGT R FD Sbjct: 170 HSAGAQVVRVLQQMLADKAFKGYENTSENWVLSLTSLSGAFNGTTRTYFD 219 >gb|AFX67039.1| lipase, partial [Solanum tuberosum] Length = 329 Score = 57.8 bits (138), Expect = 9e-07 Identities = 32/50 (64%), Positives = 35/50 (70%) Frame = +2 Query: 5 HLAWWWVVRLLQ*MLEDKAFKGYESTSPN*VLSITLLSCLFNGTRRMDFD 154 H A VVR+LQ ML DKAFKGYE+T N VLS+T LS FNGT R FD Sbjct: 37 HSAGAQVVRVLQQMLADKAFKGYENTCENWVLSVTALSGAFNGTTRTYFD 86 >ref|XP_004168442.1| PREDICTED: LOW QUALITY PROTEIN: lipase-like [Cucumis sativus] Length = 463 Score = 55.8 bits (133), Expect = 4e-06 Identities = 30/50 (60%), Positives = 36/50 (72%) Frame = +2 Query: 5 HLAWWWVVRLLQ*MLEDKAFKGYESTSPN*VLSITLLSCLFNGTRRMDFD 154 H A VVR+LQ ML DKAFKGYE+T+ N ++SIT LS +FNGT R D Sbjct: 169 HSAGAQVVRVLQQMLADKAFKGYENTTENWIISITSLSGVFNGTTRTYLD 218 >ref|XP_004142969.1| PREDICTED: lipase-like [Cucumis sativus] Length = 463 Score = 55.8 bits (133), Expect = 4e-06 Identities = 30/50 (60%), Positives = 36/50 (72%) Frame = +2 Query: 5 HLAWWWVVRLLQ*MLEDKAFKGYESTSPN*VLSITLLSCLFNGTRRMDFD 154 H A VVR+LQ ML DKAFKGYE+T+ N ++SIT LS +FNGT R D Sbjct: 169 HSAGAQVVRVLQQMLADKAFKGYENTTENWIISITSLSGVFNGTTRTYLD 218