BLASTX nr result
ID: Cephaelis21_contig00015019
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00015019 (1274 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267372.1| PREDICTED: uncharacterized protein At4g13200... 70 1e-09 ref|XP_002521111.1| conserved hypothetical protein [Ricinus comm... 68 6e-09 ref|NP_193056.1| uncharacterized protein [Arabidopsis thaliana] ... 66 2e-08 gb|AAM62995.1| unknown [Arabidopsis thaliana] 66 2e-08 ref|XP_002301776.1| predicted protein [Populus trichocarpa] gi|1... 65 4e-08 >ref|XP_002267372.1| PREDICTED: uncharacterized protein At4g13200, chloroplastic [Vitis vinifera] gi|297744310|emb|CBI37280.3| unnamed protein product [Vitis vinifera] Length = 195 Score = 70.1 bits (170), Expect = 1e-09 Identities = 35/52 (67%), Positives = 44/52 (84%) Frame = -3 Query: 180 SGENKNKTILDVFFLGKALMESTNECIEFTVGKFLTVIGRLQAEQQK*V*DF 25 SG++ +++ILD FFLGKAL E+ NE IE TVG+FL+V+GRLQAEQQK V DF Sbjct: 68 SGDSDSRSILDAFFLGKALAEALNERIESTVGEFLSVVGRLQAEQQKQVQDF 119 >ref|XP_002521111.1| conserved hypothetical protein [Ricinus communis] gi|223539680|gb|EEF41262.1| conserved hypothetical protein [Ricinus communis] Length = 215 Score = 67.8 bits (164), Expect = 6e-09 Identities = 31/52 (59%), Positives = 43/52 (82%) Frame = -3 Query: 180 SGENKNKTILDVFFLGKALMESTNECIEFTVGKFLTVIGRLQAEQQK*V*DF 25 SG+N+++++LD FFLGKAL E+ NE +E VG+FL+ IGRLQAEQQ+ + DF Sbjct: 74 SGDNESRSVLDAFFLGKALAEAVNERVESAVGEFLSTIGRLQAEQQRQIQDF 125 >ref|NP_193056.1| uncharacterized protein [Arabidopsis thaliana] gi|147742899|sp|Q8LDV3.2|Y4320_ARATH RecName: Full=Uncharacterized protein At4g13200, chloroplastic; Flags: Precursor gi|4753654|emb|CAB41930.1| putative protein [Arabidopsis thaliana] gi|7268022|emb|CAB78362.1| putative protein [Arabidopsis thaliana] gi|17380654|gb|AAL36157.1| unknown protein [Arabidopsis thaliana] gi|21436277|gb|AAM51277.1| unknown protein [Arabidopsis thaliana] gi|332657844|gb|AEE83244.1| uncharacterized protein [Arabidopsis thaliana] Length = 185 Score = 65.9 bits (159), Expect = 2e-08 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = -3 Query: 180 SGENKNKTILDVFFLGKALMESTNECIEFTVGKFLTVIGRLQAEQQK 40 SGEN+NK++LD FFLGKAL E NE IE TVG+ L+ IG+ QAEQQK Sbjct: 64 SGENENKSVLDAFFLGKALAEVINERIESTVGEVLSTIGKFQAEQQK 110 >gb|AAM62995.1| unknown [Arabidopsis thaliana] Length = 185 Score = 65.9 bits (159), Expect = 2e-08 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = -3 Query: 180 SGENKNKTILDVFFLGKALMESTNECIEFTVGKFLTVIGRLQAEQQK 40 SGEN+NK++LD FFLGKAL E NE IE TVG+ L+ IG+ QAEQQK Sbjct: 64 SGENENKSVLDAFFLGKALAEVINERIESTVGEVLSTIGKFQAEQQK 110 >ref|XP_002301776.1| predicted protein [Populus trichocarpa] gi|118484006|gb|ABK93890.1| unknown [Populus trichocarpa] gi|222843502|gb|EEE81049.1| predicted protein [Populus trichocarpa] Length = 209 Score = 65.1 bits (157), Expect = 4e-08 Identities = 30/54 (55%), Positives = 43/54 (79%) Frame = -3 Query: 186 NVSGENKNKTILDVFFLGKALMESTNECIEFTVGKFLTVIGRLQAEQQK*V*DF 25 + SG++ ++++LD FFLGKA+ E+ NE +E VG+FL+ IGRLQAEQQK + DF Sbjct: 84 SASGDSDSRSVLDAFFLGKAVAEALNERVESAVGEFLSTIGRLQAEQQKQIQDF 137