BLASTX nr result
ID: Cephaelis21_contig00015018
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00015018 (561 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316993.1| predicted protein [Populus trichocarpa] gi|2... 90 2e-16 ref|XP_003551891.1| PREDICTED: uncharacterized protein LOC100796... 88 8e-16 ref|XP_003532118.1| PREDICTED: uncharacterized protein LOC100781... 88 8e-16 ref|XP_002522974.1| transporter, putative [Ricinus communis] gi|... 87 2e-15 ref|XP_003600052.1| hypothetical protein MTR_3g051190 [Medicago ... 85 9e-15 >ref|XP_002316993.1| predicted protein [Populus trichocarpa] gi|222860058|gb|EEE97605.1| predicted protein [Populus trichocarpa] Length = 496 Score = 90.1 bits (222), Expect = 2e-16 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = +3 Query: 369 GFRSFVWTSVSYQLKNNLKLSPSASQFVSSIAFFPWSIKPLYGYVS 506 GFRSFVWT+VSYQLK+NLKLSPSASQFVSSIAFFPWSIKPLYG +S Sbjct: 28 GFRSFVWTAVSYQLKDNLKLSPSASQFVSSIAFFPWSIKPLYGILS 73 >ref|XP_003551891.1| PREDICTED: uncharacterized protein LOC100796680 [Glycine max] Length = 493 Score = 88.2 bits (217), Expect = 8e-16 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = +3 Query: 369 GFRSFVWTSVSYQLKNNLKLSPSASQFVSSIAFFPWSIKPLYGYVS 506 GFRSFVWTS+SYQLK+NLKLSPSASQFV S+AFFPWSIKPLYG +S Sbjct: 28 GFRSFVWTSISYQLKDNLKLSPSASQFVFSVAFFPWSIKPLYGILS 73 >ref|XP_003532118.1| PREDICTED: uncharacterized protein LOC100781251 [Glycine max] Length = 493 Score = 88.2 bits (217), Expect = 8e-16 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = +3 Query: 369 GFRSFVWTSVSYQLKNNLKLSPSASQFVSSIAFFPWSIKPLYGYVS 506 GFRSFVWTS+SYQLK+NLKLSPSASQFV S+AFFPWSIKPLYG +S Sbjct: 28 GFRSFVWTSISYQLKDNLKLSPSASQFVFSVAFFPWSIKPLYGILS 73 >ref|XP_002522974.1| transporter, putative [Ricinus communis] gi|223537786|gb|EEF39404.1| transporter, putative [Ricinus communis] Length = 497 Score = 86.7 bits (213), Expect = 2e-15 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 369 GFRSFVWTSVSYQLKNNLKLSPSASQFVSSIAFFPWSIKPLYGYVS 506 GFRSFVWT+VSY LK+ LKLSPSASQFVSS+AFFPWSIKPLYG VS Sbjct: 28 GFRSFVWTAVSYHLKDRLKLSPSASQFVSSVAFFPWSIKPLYGIVS 73 >ref|XP_003600052.1| hypothetical protein MTR_3g051190 [Medicago truncatula] gi|355489100|gb|AES70303.1| hypothetical protein MTR_3g051190 [Medicago truncatula] Length = 495 Score = 84.7 bits (208), Expect = 9e-15 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = +3 Query: 369 GFRSFVWTSVSYQLKNNLKLSPSASQFVSSIAFFPWSIKPLYGYVS 506 GFRSFVWT++SYQLK+NL LSPSASQFV S+AFFPWSIKPLYG +S Sbjct: 28 GFRSFVWTAISYQLKDNLHLSPSASQFVFSVAFFPWSIKPLYGILS 73