BLASTX nr result
ID: Cephaelis21_contig00014408
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00014408 (1767 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB44681.1| mitochondrial carrier-like protein [Arabidopsis ... 49 4e-10 ref|XP_002868906.1| predicted protein [Arabidopsis lyrata subsp.... 49 4e-10 ref|NP_568060.1| S-adenosylmethionine carrier 1 [Arabidopsis tha... 49 4e-10 emb|CAF25317.1| S-adenosylmethionine transporter [Capsicum annuum] 51 3e-09 ref|XP_002530256.1| mitochondrial carrier protein, putative [Ric... 47 3e-09 >emb|CAB44681.1| mitochondrial carrier-like protein [Arabidopsis thaliana] gi|7270930|emb|CAB80609.1| mitochondrial carrier-like protein [Arabidopsis thaliana] Length = 330 Score = 48.9 bits (115), Expect(3) = 4e-10 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = +2 Query: 368 KRFFSSISMQEDKPFDFFRTLVDGVIAGG 454 K FF+S++ QEDKPFDFFRTL +G IAGG Sbjct: 34 KGFFASVNTQEDKPFDFFRTLFEGFIAGG 62 Score = 39.7 bits (91), Expect(3) = 4e-10 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +3 Query: 576 PIDTIKTRLQAAHGGGKINLK 638 PIDTIKTRLQAA GGGKI LK Sbjct: 74 PIDTIKTRLQAARGGGKIVLK 94 Score = 23.1 bits (48), Expect(3) = 4e-10 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +1 Query: 193 MGPLTLSFNGKSDSVNSSD 249 M PLTLS + KS S S D Sbjct: 1 MAPLTLSVDVKSSSATSHD 19 >ref|XP_002868906.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297314742|gb|EFH45165.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 325 Score = 48.9 bits (115), Expect(3) = 4e-10 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = +2 Query: 368 KRFFSSISMQEDKPFDFFRTLVDGVIAGG 454 K FF+S++ QEDKPFDFFRTL +G IAGG Sbjct: 34 KGFFASVNTQEDKPFDFFRTLFEGFIAGG 62 Score = 39.7 bits (91), Expect(3) = 4e-10 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +3 Query: 576 PIDTIKTRLQAAHGGGKINLK 638 PIDTIKTRLQAA GGGKI LK Sbjct: 74 PIDTIKTRLQAARGGGKIVLK 94 Score = 23.1 bits (48), Expect(3) = 4e-10 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +1 Query: 193 MGPLTLSFNGKSDSVNSSD 249 M PLTLS + KS S S D Sbjct: 1 MAPLTLSVDVKSSSATSPD 19 >ref|NP_568060.1| S-adenosylmethionine carrier 1 [Arabidopsis thaliana] gi|334187328|ref|NP_001190968.1| S-adenosylmethionine carrier 1 [Arabidopsis thaliana] gi|15028275|gb|AAK76726.1| putative mitochondrial carrier protein [Arabidopsis thaliana] gi|19310699|gb|AAL85080.1| putative mitochondrial carrier protein [Arabidopsis thaliana] gi|117585040|emb|CAJ91123.1| S-adenosylmethionine carrier [Arabidopsis thaliana] gi|119391877|emb|CAF29517.1| S-adenosylmethionine transporter [Arabidopsis thaliana] gi|332661674|gb|AEE87074.1| S-adenosylmethionine carrier 1 [Arabidopsis thaliana] gi|332661675|gb|AEE87075.1| S-adenosylmethionine carrier 1 [Arabidopsis thaliana] Length = 325 Score = 48.9 bits (115), Expect(3) = 4e-10 Identities = 21/29 (72%), Positives = 25/29 (86%) Frame = +2 Query: 368 KRFFSSISMQEDKPFDFFRTLVDGVIAGG 454 K FF+S++ QEDKPFDFFRTL +G IAGG Sbjct: 34 KGFFASVNTQEDKPFDFFRTLFEGFIAGG 62 Score = 39.7 bits (91), Expect(3) = 4e-10 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = +3 Query: 576 PIDTIKTRLQAAHGGGKINLK 638 PIDTIKTRLQAA GGGKI LK Sbjct: 74 PIDTIKTRLQAARGGGKIVLK 94 Score = 23.1 bits (48), Expect(3) = 4e-10 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +1 Query: 193 MGPLTLSFNGKSDSVNSSD 249 M PLTLS + KS S S D Sbjct: 1 MAPLTLSVDVKSSSATSHD 19 >emb|CAF25317.1| S-adenosylmethionine transporter [Capsicum annuum] Length = 326 Score = 51.2 bits (121), Expect(2) = 3e-09 Identities = 22/35 (62%), Positives = 29/35 (82%) Frame = +2 Query: 350 SIQFRPKRFFSSISMQEDKPFDFFRTLVDGVIAGG 454 S+Q PK+FF+SI+ +E+KPFDF R L +GVIAGG Sbjct: 30 SLQMLPKKFFASINNEEEKPFDFLRILFEGVIAGG 64 Score = 38.1 bits (87), Expect(2) = 3e-09 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +3 Query: 576 PIDTIKTRLQAAHGGGKINLK 638 PIDTIKTRLQAA GGG+I LK Sbjct: 76 PIDTIKTRLQAARGGGQIVLK 96 >ref|XP_002530256.1| mitochondrial carrier protein, putative [Ricinus communis] gi|223530222|gb|EEF32126.1| mitochondrial carrier protein, putative [Ricinus communis] Length = 325 Score = 46.6 bits (109), Expect(2) = 3e-09 Identities = 20/35 (57%), Positives = 28/35 (80%) Frame = +2 Query: 350 SIQFRPKRFFSSISMQEDKPFDFFRTLVDGVIAGG 454 S Q ++ F+S+S+++DKPFDF RTL +GVIAGG Sbjct: 28 SSQLETRKAFASMSVKDDKPFDFLRTLFEGVIAGG 62 Score = 42.7 bits (99), Expect(2) = 3e-09 Identities = 20/21 (95%), Positives = 20/21 (95%) Frame = +3 Query: 576 PIDTIKTRLQAAHGGGKINLK 638 PIDTIKTRLQAAHGGGKI LK Sbjct: 74 PIDTIKTRLQAAHGGGKIVLK 94