BLASTX nr result
ID: Cephaelis21_contig00014388
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00014388 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002319693.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|XP_002525423.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002319693.1| predicted protein [Populus trichocarpa] gi|222858069|gb|EEE95616.1| predicted protein [Populus trichocarpa] Length = 82 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/57 (50%), Positives = 34/57 (59%), Gaps = 5/57 (8%) Frame = +3 Query: 3 LCQYIACNPETLPPNQVLYLIFCFPFQQIRRLAVCLCTVFCFPP-----PGSDSPFY 158 LCQYIACNPE L +QVL+L+FC P RLA+ T C+ P P SDS Y Sbjct: 18 LCQYIACNPERLSSDQVLHLLFCLPLHHFGRLALSFWTYLCYSPTPANLPDSDSDAY 74 >ref|XP_002525423.1| conserved hypothetical protein [Ricinus communis] gi|223535236|gb|EEF36913.1| conserved hypothetical protein [Ricinus communis] Length = 84 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/53 (50%), Positives = 34/53 (64%), Gaps = 1/53 (1%) Frame = +3 Query: 3 LCQYIACNPETLPPNQVLYLIFCFPFQQIRRLAVCLCTVFCFPP-PGSDSPFY 158 +CQYIACNPE L +QVL L+FC P + RLA+ L C+ P P + S FY Sbjct: 18 VCQYIACNPERLSSDQVLNLLFCLPLRHFGRLALSLWNYLCYNPYPSNLSAFY 70