BLASTX nr result
ID: Cephaelis21_contig00014205
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00014205 (204 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530188.1| conserved hypothetical protein [Ricinus comm... 59 3e-07 ref|XP_002867409.1| F-box family protein [Arabidopsis lyrata sub... 56 3e-06 ref|XP_004147091.1| PREDICTED: F-box/LRR-repeat protein At4g2942... 56 3e-06 >ref|XP_002530188.1| conserved hypothetical protein [Ricinus communis] gi|223530307|gb|EEF32202.1| conserved hypothetical protein [Ricinus communis] Length = 460 Score = 59.3 bits (142), Expect = 3e-07 Identities = 24/42 (57%), Positives = 36/42 (85%) Frame = -1 Query: 204 WTVSNAVSSVTIVAPSLVKLKLKCVRPRALVIETPSMTDLYL 79 WTVSNA +S++I AP+L+KL+L C+ PR+L++ETP ++D YL Sbjct: 234 WTVSNAPNSLSIFAPNLLKLELNCIEPRSLILETPLLSDFYL 275 >ref|XP_002867409.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297313245|gb|EFH43668.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] Length = 445 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/64 (42%), Positives = 44/64 (68%) Frame = -1 Query: 204 WTVSNAVSSVTIVAPSLVKLKLKCVRPRALVIETPSMTDLYLLPF*IRSFKNNDWGIFKP 25 WTVSNA S+ IVAP+L++LKLKC +P++L++ETP + + F + + +G F+ Sbjct: 225 WTVSNAPLSLAIVAPNLLELKLKCNKPKSLILETPKLVKFH---FSVEDAEGVGFGEFRD 281 Query: 24 ISSL 13 ++SL Sbjct: 282 LNSL 285 >ref|XP_004147091.1| PREDICTED: F-box/LRR-repeat protein At4g29420-like [Cucumis sativus] gi|449503313|ref|XP_004161940.1| PREDICTED: F-box/LRR-repeat protein At4g29420-like [Cucumis sativus] Length = 449 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = -1 Query: 204 WTVSNAVSSVTIVAPSLVKLKLKCVRPRALVIETPSMTDLY 82 WTVSNA S+ I APSL KL+LKCV+P+ L+IETP ++D + Sbjct: 229 WTVSNAPVSLCIYAPSLSKLELKCVKPKFLIIETPMLSDFH 269