BLASTX nr result
ID: Cephaelis21_contig00014119
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00014119 (355 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530136.1| 60S ribosomal protein L18a, plant, putative ... 102 3e-20 gb|ADR71269.1| 60S ribosomal protein L18aA [Hevea brasiliensis] 102 4e-20 ref|XP_002268796.1| PREDICTED: 60S ribosomal protein L18a-1 [Vit... 102 4e-20 emb|CAN75635.1| hypothetical protein VITISV_044171 [Vitis vinifera] 102 4e-20 ref|NP_564634.1| Ribosomal protein L18ae family [Arabidopsis tha... 97 1e-18 >ref|XP_002530136.1| 60S ribosomal protein L18a, plant, putative [Ricinus communis] gi|223530361|gb|EEF32252.1| 60S ribosomal protein L18a, plant, putative [Ricinus communis] Length = 166 Score = 102 bits (254), Expect = 3e-20 Identities = 44/59 (74%), Positives = 49/59 (83%) Frame = +3 Query: 3 GYVVAEGTPVARERRLPCCGIGLGWFCFIIGFLFVGIPWYIAAFIILCAKVDPREKPGY 179 GY VAEG PV RERRLPCCGIG+GWF FIIGF IPWY+ FI+LCA++DPREKPGY Sbjct: 84 GYAVAEGRPV-RERRLPCCGIGVGWFLFIIGFFLGAIPWYVGLFILLCARIDPREKPGY 141 >gb|ADR71269.1| 60S ribosomal protein L18aA [Hevea brasiliensis] Length = 151 Score = 102 bits (253), Expect = 4e-20 Identities = 43/59 (72%), Positives = 49/59 (83%) Frame = +3 Query: 3 GYVVAEGTPVARERRLPCCGIGLGWFCFIIGFLFVGIPWYIAAFIILCAKVDPREKPGY 179 GY VAEG PV RERRLPCCGIG+GWF FIIGF IPWY+ F++LCA++DPREKPGY Sbjct: 70 GYAVAEGRPV-RERRLPCCGIGVGWFLFIIGFFLGAIPWYVGLFVLLCARIDPREKPGY 127 >ref|XP_002268796.1| PREDICTED: 60S ribosomal protein L18a-1 [Vitis vinifera] gi|296082825|emb|CBI22126.3| unnamed protein product [Vitis vinifera] Length = 143 Score = 102 bits (253), Expect = 4e-20 Identities = 44/59 (74%), Positives = 49/59 (83%) Frame = +3 Query: 3 GYVVAEGTPVARERRLPCCGIGLGWFCFIIGFLFVGIPWYIAAFIILCAKVDPREKPGY 179 GY VAEGTPV RERRLPCCGIGLGWF FIIGF +PWY+ F++LCA+VD REKPGY Sbjct: 62 GYAVAEGTPV-RERRLPCCGIGLGWFLFIIGFFLAAVPWYVGFFLLLCARVDYREKPGY 119 >emb|CAN75635.1| hypothetical protein VITISV_044171 [Vitis vinifera] Length = 141 Score = 102 bits (253), Expect = 4e-20 Identities = 44/59 (74%), Positives = 49/59 (83%) Frame = +3 Query: 3 GYVVAEGTPVARERRLPCCGIGLGWFCFIIGFLFVGIPWYIAAFIILCAKVDPREKPGY 179 GY VAEGTPV RERRLPCCGIGLGWF FIIGF +PWY+ F++LCA+VD REKPGY Sbjct: 62 GYAVAEGTPV-RERRLPCCGIGLGWFLFIIGFFLAAVPWYVGFFLLLCARVDYREKPGY 119 >ref|NP_564634.1| Ribosomal protein L18ae family [Arabidopsis thaliana] gi|8671871|gb|AAF78434.1|AC018748_13 Contains similarity to swi4 protein from Schizosaccharomyces pombe gi|1076927 [Arabidopsis thaliana] gi|12324020|gb|AAG51969.1|AC024260_7 hypothetical protein; 86225-87277 [Arabidopsis thaliana] gi|20466666|gb|AAM20650.1| unknown protein [Arabidopsis thaliana] gi|30102872|gb|AAP21354.1| At1g53560 [Arabidopsis thaliana] gi|332194838|gb|AEE32959.1| Ribosomal protein L18ae family [Arabidopsis thaliana] Length = 153 Score = 97.4 bits (241), Expect = 1e-18 Identities = 40/59 (67%), Positives = 49/59 (83%) Frame = +3 Query: 3 GYVVAEGTPVARERRLPCCGIGLGWFCFIIGFLFVGIPWYIAAFIILCAKVDPREKPGY 179 GY V++G P AR+ RLPCCG+GLGWF FIIGFL IPWY+ FI++CA++DPREKPGY Sbjct: 70 GYPVSQGRP-ARQNRLPCCGLGLGWFLFIIGFLLGAIPWYVGVFILVCARIDPREKPGY 127