BLASTX nr result
ID: Cephaelis21_contig00013976
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00013976 (200 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABB88839.2| NADPH cytochrome P450 reductase [Stevia rebaudiana] 81 1e-13 gb|AFO64618.1| cytochrome P450 reductase [Artemisia annua] 80 1e-13 gb|ACP43317.1| NADPH cytochrome P450 reductase [Citrus maxima] 80 1e-13 gb|ABM88789.1| cytochrome P450 reductase [Artemisia annua] 80 1e-13 gb|ABL09938.1| cytochrome P450 reductase [Artemisia annua] 80 1e-13 >gb|ABB88839.2| NADPH cytochrome P450 reductase [Stevia rebaudiana] Length = 710 Score = 80.9 bits (198), Expect = 1e-13 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -3 Query: 198 AKDVHRTIHTIVQEQGSMDSSKAESYVKNLQMTGRYLRDVW 76 AKDVHRT+HTIVQEQGS+DSSKAE YVKNLQM+GRYLRDVW Sbjct: 670 AKDVHRTLHTIVQEQGSLDSSKAELYVKNLQMSGRYLRDVW 710 >gb|AFO64618.1| cytochrome P450 reductase [Artemisia annua] Length = 704 Score = 80.5 bits (197), Expect = 1e-13 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -3 Query: 198 AKDVHRTIHTIVQEQGSMDSSKAESYVKNLQMTGRYLRDVW 76 AKDVHRT+HTIVQEQGS+DSSKAE YVKNLQM GRYLRDVW Sbjct: 664 AKDVHRTLHTIVQEQGSLDSSKAELYVKNLQMAGRYLRDVW 704 >gb|ACP43317.1| NADPH cytochrome P450 reductase [Citrus maxima] Length = 209 Score = 80.5 bits (197), Expect = 1e-13 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -3 Query: 198 AKDVHRTIHTIVQEQGSMDSSKAESYVKNLQMTGRYLRDVW 76 A+DVHRT+HTIVQEQGS+DSSKAES VKNLQMTGRYLRDVW Sbjct: 169 ARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMTGRYLRDVW 209 >gb|ABM88789.1| cytochrome P450 reductase [Artemisia annua] Length = 704 Score = 80.5 bits (197), Expect = 1e-13 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -3 Query: 198 AKDVHRTIHTIVQEQGSMDSSKAESYVKNLQMTGRYLRDVW 76 AKDVHRT+HTIVQEQGS+DSSKAE YVKNLQM GRYLRDVW Sbjct: 664 AKDVHRTLHTIVQEQGSLDSSKAELYVKNLQMAGRYLRDVW 704 >gb|ABL09938.1| cytochrome P450 reductase [Artemisia annua] Length = 704 Score = 80.5 bits (197), Expect = 1e-13 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -3 Query: 198 AKDVHRTIHTIVQEQGSMDSSKAESYVKNLQMTGRYLRDVW 76 AKDVHRT+HTIVQEQGS+DSSKAE YVKNLQM GRYLRDVW Sbjct: 664 AKDVHRTLHTIVQEQGSLDSSKAELYVKNLQMAGRYLRDVW 704