BLASTX nr result
ID: Cephaelis21_contig00013860
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00013860 (384 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA58672.1| TPA: putative 60S ribosomal protein L19-3 family... 70 2e-10 tpg|DAA58674.1| TPA: putative 60S ribosomal protein L19-3 family... 68 7e-10 gb|AFC88841.1| 60S ribosomal protein L19-like protein [Miscanthu... 68 7e-10 ref|XP_002453326.1| hypothetical protein SORBIDRAFT_04g003890 [S... 68 7e-10 ref|XP_002458037.1| hypothetical protein SORBIDRAFT_03g025960 [S... 68 7e-10 >tpg|DAA58672.1| TPA: putative 60S ribosomal protein L19-3 family protein, partial [Zea mays] Length = 85 Score = 70.1 bits (170), Expect = 2e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +3 Query: 282 KMVSLKLQKRLAASVLKCGKGKVWLDPNEVSEIS 383 KMVSLKLQKRLAASVLKCGKGKVWLDPNEVSEIS Sbjct: 38 KMVSLKLQKRLAASVLKCGKGKVWLDPNEVSEIS 71 >tpg|DAA58674.1| TPA: putative 60S ribosomal protein L19-3 family protein [Zea mays] Length = 200 Score = 68.2 bits (165), Expect = 7e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 285 MVSLKLQKRLAASVLKCGKGKVWLDPNEVSEIS 383 MVSLKLQKRLAASVLKCGKGKVWLDPNEVSEIS Sbjct: 1 MVSLKLQKRLAASVLKCGKGKVWLDPNEVSEIS 33 >gb|AFC88841.1| 60S ribosomal protein L19-like protein [Miscanthus sinensis] Length = 207 Score = 68.2 bits (165), Expect = 7e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 285 MVSLKLQKRLAASVLKCGKGKVWLDPNEVSEIS 383 MVSLKLQKRLAASVLKCGKGKVWLDPNEVSEIS Sbjct: 1 MVSLKLQKRLAASVLKCGKGKVWLDPNEVSEIS 33 >ref|XP_002453326.1| hypothetical protein SORBIDRAFT_04g003890 [Sorghum bicolor] gi|241933157|gb|EES06302.1| hypothetical protein SORBIDRAFT_04g003890 [Sorghum bicolor] Length = 207 Score = 68.2 bits (165), Expect = 7e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 285 MVSLKLQKRLAASVLKCGKGKVWLDPNEVSEIS 383 MVSLKLQKRLAASVLKCGKGKVWLDPNEVSEIS Sbjct: 1 MVSLKLQKRLAASVLKCGKGKVWLDPNEVSEIS 33 >ref|XP_002458037.1| hypothetical protein SORBIDRAFT_03g025960 [Sorghum bicolor] gi|241930012|gb|EES03157.1| hypothetical protein SORBIDRAFT_03g025960 [Sorghum bicolor] Length = 207 Score = 68.2 bits (165), Expect = 7e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 285 MVSLKLQKRLAASVLKCGKGKVWLDPNEVSEIS 383 MVSLKLQKRLAASVLKCGKGKVWLDPNEVSEIS Sbjct: 1 MVSLKLQKRLAASVLKCGKGKVWLDPNEVSEIS 33