BLASTX nr result
ID: Cephaelis21_contig00013659
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00013659 (464 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001236735.1| uncharacterized protein LOC100306047 [Glycin... 92 3e-17 gb|AFK35630.1| unknown [Lotus japonicus] 91 7e-17 ref|XP_002283179.1| PREDICTED: AP-4 complex subunit sigma [Vitis... 91 1e-16 ref|XP_002514188.1| AP-4 complex subunit sigma-1, putative [Rici... 90 2e-16 ref|XP_002308286.1| predicted protein [Populus trichocarpa] gi|2... 90 2e-16 >ref|NP_001236735.1| uncharacterized protein LOC100306047 [Glycine max] gi|356494887|ref|XP_003516313.1| PREDICTED: AP-4 complex subunit sigma-like [Glycine max] gi|255627383|gb|ACU14036.1| unknown [Glycine max] Length = 143 Score = 92.4 bits (228), Expect = 3e-17 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = +3 Query: 324 MGIRFILMVNKQGQTRLAQYYEYLTIEERRALEGEIVRKCLARTEQQ 464 MGIRF+LMVNKQGQTRLAQYYEYLT+EERRALEGEIVRKCLAR EQQ Sbjct: 1 MGIRFVLMVNKQGQTRLAQYYEYLTLEERRALEGEIVRKCLARNEQQ 47 >gb|AFK35630.1| unknown [Lotus japonicus] Length = 143 Score = 91.3 bits (225), Expect = 7e-17 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = +3 Query: 324 MGIRFILMVNKQGQTRLAQYYEYLTIEERRALEGEIVRKCLARTEQQ 464 MGIRF+LMVNKQGQTRLAQYYEYLTIEERRALEGEIVRKCLAR E Q Sbjct: 1 MGIRFVLMVNKQGQTRLAQYYEYLTIEERRALEGEIVRKCLARNEHQ 47 >ref|XP_002283179.1| PREDICTED: AP-4 complex subunit sigma [Vitis vinifera] Length = 143 Score = 90.9 bits (224), Expect = 1e-16 Identities = 44/47 (93%), Positives = 45/47 (95%) Frame = +3 Query: 324 MGIRFILMVNKQGQTRLAQYYEYLTIEERRALEGEIVRKCLARTEQQ 464 MGIRFILMVNKQGQTRLAQYYEYL +EERRALEGEIVRKCLAR EQQ Sbjct: 1 MGIRFILMVNKQGQTRLAQYYEYLNLEERRALEGEIVRKCLARNEQQ 47 >ref|XP_002514188.1| AP-4 complex subunit sigma-1, putative [Ricinus communis] gi|223546644|gb|EEF48142.1| AP-4 complex subunit sigma-1, putative [Ricinus communis] Length = 143 Score = 89.7 bits (221), Expect = 2e-16 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = +3 Query: 324 MGIRFILMVNKQGQTRLAQYYEYLTIEERRALEGEIVRKCLARTEQQ 464 MGIRFILMVNKQGQTRLAQYYE+LT+EERRALEGEIVRKCLAR +QQ Sbjct: 1 MGIRFILMVNKQGQTRLAQYYEWLTLEERRALEGEIVRKCLARNDQQ 47 >ref|XP_002308286.1| predicted protein [Populus trichocarpa] gi|222854262|gb|EEE91809.1| predicted protein [Populus trichocarpa] Length = 143 Score = 89.7 bits (221), Expect = 2e-16 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = +3 Query: 324 MGIRFILMVNKQGQTRLAQYYEYLTIEERRALEGEIVRKCLARTEQQ 464 MGIRFILMVNKQGQTRLAQYYE+LT+EERRALEGEIVRKCLAR +QQ Sbjct: 1 MGIRFILMVNKQGQTRLAQYYEWLTLEERRALEGEIVRKCLARNDQQ 47