BLASTX nr result
ID: Cephaelis21_contig00012459
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00012459 (346 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316747.1| predicted protein [Populus trichocarpa] gi|2... 60 1e-07 ref|XP_004164255.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|NP_001031667.1| pentatricopeptide repeat-containing protein ... 56 4e-06 ref|NP_567571.1| pentatricopeptide repeat-containing protein [Ar... 56 4e-06 gb|AAT06467.1| At4g18975 [Arabidopsis thaliana] gi|62320588|dbj|... 56 4e-06 >ref|XP_002316747.1| predicted protein [Populus trichocarpa] gi|222859812|gb|EEE97359.1| predicted protein [Populus trichocarpa] Length = 272 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +2 Query: 254 VIKKKGTKEHHLWQKRDSAGSGQKALNLVR 343 V+KK G KEHHLWQKRDSAGSGQKALNLVR Sbjct: 59 VVKKSGKKEHHLWQKRDSAGSGQKALNLVR 88 >ref|XP_004164255.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18975, chloroplastic-like [Cucumis sativus] Length = 270 Score = 56.6 bits (135), Expect = 2e-06 Identities = 30/81 (37%), Positives = 42/81 (51%) Frame = +2 Query: 101 VNCFFFLSPFSLDVSAAFCWRPCIYRFLLSHVLFEYEVLYLSTFFSRKSGTVIKKKGTKE 280 ++C ++ + F+ S+ C + T F+ V+KK G + Sbjct: 18 IDCIYYHNKFTFTPSSVIC--------------VHNQAAQPLTSFTTPERRVVKKVGKET 63 Query: 281 HHLWQKRDSAGSGQKALNLVR 343 HHLW+KRDSAGSGQKALNLVR Sbjct: 64 HHLWKKRDSAGSGQKALNLVR 84 >ref|NP_001031667.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332658716|gb|AEE84116.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 260 Score = 55.8 bits (133), Expect = 4e-06 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = +2 Query: 218 YLSTFFSRKSGTVIKKKGTKEHHLWQKRDSAGSGQKALNLVR 343 Y++T S++ IKK G KEHHLW+K DSAGSGQKALNLVR Sbjct: 39 YVATVNSKE----IKKVGKKEHHLWKKNDSAGSGQKALNLVR 76 >ref|NP_567571.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|186512032|ref|NP_001119009.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|334186688|ref|NP_001190768.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635632|sp|Q2V3H0.2|PP322_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g18975, chloroplastic; Flags: Precursor gi|332658715|gb|AEE84115.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332658717|gb|AEE84117.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332658718|gb|AEE84118.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 287 Score = 55.8 bits (133), Expect = 4e-06 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = +2 Query: 218 YLSTFFSRKSGTVIKKKGTKEHHLWQKRDSAGSGQKALNLVR 343 Y++T S++ IKK G KEHHLW+K DSAGSGQKALNLVR Sbjct: 66 YVATVNSKE----IKKVGKKEHHLWKKNDSAGSGQKALNLVR 103 >gb|AAT06467.1| At4g18975 [Arabidopsis thaliana] gi|62320588|dbj|BAD95227.1| hypothetical protein [Arabidopsis thaliana] Length = 152 Score = 55.8 bits (133), Expect = 4e-06 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = +2 Query: 218 YLSTFFSRKSGTVIKKKGTKEHHLWQKRDSAGSGQKALNLVR 343 Y++T S++ IKK G KEHHLW+K DSAGSGQKALNLVR Sbjct: 66 YVATVNSKE----IKKVGKKEHHLWKKNDSAGSGQKALNLVR 103