BLASTX nr result
ID: Cephaelis21_contig00012451
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00012451 (495 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511810.1| acyl-CoA thioesterase, putative [Ricinus com... 72 6e-11 ref|XP_002511812.1| acyl-CoA thioesterase, putative [Ricinus com... 64 2e-08 ref|XP_002320776.1| predicted protein [Populus trichocarpa] gi|2... 64 2e-08 ref|XP_002511809.1| acyl-CoA thioesterase, putative [Ricinus com... 63 2e-08 ref|XP_002270993.1| PREDICTED: uncharacterized protein LOC100254... 63 2e-08 >ref|XP_002511810.1| acyl-CoA thioesterase, putative [Ricinus communis] gi|223548990|gb|EEF50479.1| acyl-CoA thioesterase, putative [Ricinus communis] Length = 184 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/44 (75%), Positives = 41/44 (93%) Frame = +3 Query: 12 VVDGSLVRSGRNLTVVAIEFKLEESGKLVYTSRATLYHLPTASL 143 VVDGS VRSGRNLTVVA+EF+++++GKLVYT+RATLYH+P A L Sbjct: 141 VVDGSTVRSGRNLTVVAMEFRIKKTGKLVYTARATLYHMPIAKL 184 >ref|XP_002511812.1| acyl-CoA thioesterase, putative [Ricinus communis] gi|223548992|gb|EEF50481.1| acyl-CoA thioesterase, putative [Ricinus communis] Length = 185 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/45 (64%), Positives = 39/45 (86%) Frame = +3 Query: 9 VVVDGSLVRSGRNLTVVAIEFKLEESGKLVYTSRATLYHLPTASL 143 + VDGS+VRSGRNLTVVAIEF+++++ K VY +RATLYH+P + L Sbjct: 141 LAVDGSVVRSGRNLTVVAIEFRIKKTQKPVYLARATLYHMPASKL 185 >ref|XP_002320776.1| predicted protein [Populus trichocarpa] gi|222861549|gb|EEE99091.1| predicted protein [Populus trichocarpa] Length = 171 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/45 (62%), Positives = 40/45 (88%) Frame = +3 Query: 9 VVVDGSLVRSGRNLTVVAIEFKLEESGKLVYTSRATLYHLPTASL 143 ++V+GS+++SGRNLTVVA EF+++E+ KLV+TSRAT YH+P A L Sbjct: 127 LLVEGSVLKSGRNLTVVASEFRIKETKKLVFTSRATFYHMPAAKL 171 >ref|XP_002511809.1| acyl-CoA thioesterase, putative [Ricinus communis] gi|223548989|gb|EEF50478.1| acyl-CoA thioesterase, putative [Ricinus communis] Length = 182 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = +3 Query: 9 VVVDGSLVRSGRNLTVVAIEFKLEESGKLVYTSRATLYHLPTASL 143 VVVDGS+VRSGRNL+ V IEF++++S KL+YT+ TLYHLP A L Sbjct: 138 VVVDGSVVRSGRNLSAVVIEFRIKKSLKLLYTADVTLYHLPIAKL 182 >ref|XP_002270993.1| PREDICTED: uncharacterized protein LOC100254026 [Vitis vinifera] gi|296089053|emb|CBI38756.3| unnamed protein product [Vitis vinifera] Length = 176 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/45 (60%), Positives = 38/45 (84%) Frame = +3 Query: 9 VVVDGSLVRSGRNLTVVAIEFKLEESGKLVYTSRATLYHLPTASL 143 VV D S+VRSGRN+TV+A+EFK++++ KL+YT RAT Y++P A L Sbjct: 132 VVTDASVVRSGRNVTVIAVEFKMKKTSKLIYTGRATFYNMPIAKL 176