BLASTX nr result
ID: Cephaelis21_contig00012348
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00012348 (594 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001237032.1| ferritin-3, chloroplastic [Glycine max] gi|2... 87 3e-15 gb|AFO70135.1| ferritin Fer11;1 [Glycine max] 87 3e-15 ref|NP_001241944.1| uncharacterized protein LOC100810000 [Glycin... 87 3e-15 gb|ACS32300.1| ferritin [Jatropha curcas] 86 6e-15 gb|ADD25899.1| ferritin 2 [Coffea arabica] 85 1e-14 >ref|NP_001237032.1| ferritin-3, chloroplastic [Glycine max] gi|29839387|sp|Q948P6.1|FRI3_SOYBN RecName: Full=Ferritin-3, chloroplastic; AltName: Full=SFerH-3; Flags: Precursor gi|15487307|dbj|BAB64536.1| ferritin [Glycine max] Length = 256 Score = 86.7 bits (213), Expect = 3e-15 Identities = 42/46 (91%), Positives = 42/46 (91%) Frame = +1 Query: 1 ESEFLNEQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLHEHEEAA 138 ESEFL EQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLHE AA Sbjct: 211 ESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLHEEGVAA 256 >gb|AFO70135.1| ferritin Fer11;1 [Glycine max] Length = 256 Score = 86.7 bits (213), Expect = 3e-15 Identities = 42/46 (91%), Positives = 42/46 (91%) Frame = +1 Query: 1 ESEFLNEQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLHEHEEAA 138 ESEFL EQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLHE AA Sbjct: 211 ESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLHEEGVAA 256 >ref|NP_001241944.1| uncharacterized protein LOC100810000 [Glycine max] gi|255647034|gb|ACU23985.1| unknown [Glycine max] Length = 248 Score = 86.7 bits (213), Expect = 3e-15 Identities = 42/46 (91%), Positives = 42/46 (91%) Frame = +1 Query: 1 ESEFLNEQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLHEHEEAA 138 ESEFL EQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLHE AA Sbjct: 203 ESEFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLHEEGVAA 248 >gb|ACS32300.1| ferritin [Jatropha curcas] Length = 257 Score = 85.5 bits (210), Expect = 6e-15 Identities = 41/46 (89%), Positives = 42/46 (91%) Frame = +1 Query: 1 ESEFLNEQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLHEHEEAA 138 ESEFL EQV+AIKKISEYVAQLRRVGKGHGVWHFDQMLLHE E A Sbjct: 211 ESEFLAEQVDAIKKISEYVAQLRRVGKGHGVWHFDQMLLHEGEAVA 256 >gb|ADD25899.1| ferritin 2 [Coffea arabica] Length = 261 Score = 84.7 bits (208), Expect = 1e-14 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = +1 Query: 1 ESEFLNEQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLHEH 126 ESEFL EQVEAIKKISEYVAQLRRVGKGHGVWHFDQ LLHEH Sbjct: 220 ESEFLVEQVEAIKKISEYVAQLRRVGKGHGVWHFDQALLHEH 261