BLASTX nr result
ID: Cephaelis21_contig00012048
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00012048 (229 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001154627.1| calcium-dependent lipid-binding domain-conta... 55 4e-12 dbj|BAB01297.1| unnamed protein product [Arabidopsis thaliana] 55 4e-12 ref|XP_002885335.1| integral membrane single C2 domain protein [... 54 1e-11 ref|XP_003538975.1| PREDICTED: extended synaptotagmin-3-like [Gl... 52 3e-11 ref|XP_003540643.1| PREDICTED: C2 domain-containing protein At1g... 52 3e-11 >ref|NP_001154627.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis thaliana] gi|240255371|ref|NP_188617.5| calcium-dependent lipid-binding domain-containing protein [Arabidopsis thaliana] gi|210966929|emb|CAR82574.2| NTMC2T5.2 protein [Arabidopsis thaliana] gi|332642775|gb|AEE76296.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis thaliana] gi|332642776|gb|AEE76297.1| calcium-dependent lipid-binding domain-containing protein [Arabidopsis thaliana] Length = 693 Score = 55.5 bits (132), Expect(3) = 4e-12 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -2 Query: 171 RGGWKQLGRGSAGELLLRLTYKAYVEDEENER 76 RGGW G+GS GE+LLRLTYKAYVEDEE+++ Sbjct: 519 RGGWSLFGKGSTGEILLRLTYKAYVEDEEDDK 550 Score = 32.0 bits (71), Expect(3) = 4e-12 Identities = 16/25 (64%), Positives = 21/25 (84%) Frame = -3 Query: 77 GFEAKLDVPALLIVSEEFQGIVSSE 3 G E+ ++V + LI+SEEFQGIVSSE Sbjct: 586 GQESFMNVLSALILSEEFQGIVSSE 610 Score = 27.7 bits (60), Expect(3) = 4e-12 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 212 QVDLESLDDTIPTD 171 +VDLESL DT+PTD Sbjct: 500 EVDLESLPDTVPTD 513 >dbj|BAB01297.1| unnamed protein product [Arabidopsis thaliana] Length = 683 Score = 55.5 bits (132), Expect(3) = 4e-12 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -2 Query: 171 RGGWKQLGRGSAGELLLRLTYKAYVEDEENER 76 RGGW G+GS GE+LLRLTYKAYVEDEE+++ Sbjct: 492 RGGWSLFGKGSTGEILLRLTYKAYVEDEEDDK 523 Score = 32.0 bits (71), Expect(3) = 4e-12 Identities = 16/25 (64%), Positives = 21/25 (84%) Frame = -3 Query: 77 GFEAKLDVPALLIVSEEFQGIVSSE 3 G E+ ++V + LI+SEEFQGIVSSE Sbjct: 559 GQESFMNVLSALILSEEFQGIVSSE 583 Score = 27.7 bits (60), Expect(3) = 4e-12 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 212 QVDLESLDDTIPTD 171 +VDLESL DT+PTD Sbjct: 473 EVDLESLPDTVPTD 486 >ref|XP_002885335.1| integral membrane single C2 domain protein [Arabidopsis lyrata subsp. lyrata] gi|297331175|gb|EFH61594.1| integral membrane single C2 domain protein [Arabidopsis lyrata subsp. lyrata] Length = 690 Score = 53.9 bits (128), Expect(3) = 1e-11 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = -2 Query: 171 RGGWKQLGRGSAGELLLRLTYKAYVEDEENER 76 +GGW G+GS GE+LLRLTYKAYVEDEE+++ Sbjct: 516 QGGWSLFGKGSTGEILLRLTYKAYVEDEEDDK 547 Score = 32.0 bits (71), Expect(3) = 1e-11 Identities = 16/25 (64%), Positives = 21/25 (84%) Frame = -3 Query: 77 GFEAKLDVPALLIVSEEFQGIVSSE 3 G E+ ++V + LI+SEEFQGIVSSE Sbjct: 583 GQESFMNVLSALILSEEFQGIVSSE 607 Score = 27.7 bits (60), Expect(3) = 1e-11 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 212 QVDLESLDDTIPTD 171 +VDLESL DT+PTD Sbjct: 497 EVDLESLPDTVPTD 510 >ref|XP_003538975.1| PREDICTED: extended synaptotagmin-3-like [Glycine max] Length = 689 Score = 51.6 bits (122), Expect(3) = 3e-11 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = -2 Query: 171 RGGWKQLGRGSAGELLLRLTYKAYVEDEENER 76 +GGW LG+ S+GE+LLRLTYKAYVEDEE+++ Sbjct: 530 QGGWGFLGKRSSGEILLRLTYKAYVEDEEDDK 561 Score = 33.9 bits (76), Expect(3) = 3e-11 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -3 Query: 71 EAKLDVPALLIVSEEFQGIVSSE 3 E+ +DV A LIVSEEFQGIV+SE Sbjct: 599 ESFMDVLAALIVSEEFQGIVASE 621 Score = 26.6 bits (57), Expect(3) = 3e-11 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -3 Query: 221 GSIQVDLESLDDTIPTDGV 165 G+ +VDL SL DT+PTD + Sbjct: 508 GTGEVDLGSLKDTVPTDRI 526 >ref|XP_003540643.1| PREDICTED: C2 domain-containing protein At1g53590-like [Glycine max] Length = 665 Score = 51.6 bits (122), Expect(3) = 3e-11 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = -2 Query: 171 RGGWKQLGRGSAGELLLRLTYKAYVEDEENER 76 +GGW LG+ S+GE+LLRLTYKAYVEDEE+++ Sbjct: 506 QGGWGFLGKRSSGEILLRLTYKAYVEDEEDDK 537 Score = 33.9 bits (76), Expect(3) = 3e-11 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -3 Query: 71 EAKLDVPALLIVSEEFQGIVSSE 3 E+ +DV A LIVSEEFQGIV+SE Sbjct: 575 ESFMDVLAALIVSEEFQGIVASE 597 Score = 26.6 bits (57), Expect(3) = 3e-11 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -3 Query: 221 GSIQVDLESLDDTIPTDGV 165 G+ +VDL SL DT+PTD + Sbjct: 484 GTGEVDLGSLKDTVPTDRI 502