BLASTX nr result
ID: Cephaelis21_contig00011435
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00011435 (218 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI23954.3| unnamed protein product [Vitis vinifera] 79 4e-13 ref|XP_002281484.1| PREDICTED: tryptophan synthase beta chain 2,... 79 4e-13 sp|O50046.1|TRPB_CAMAC RecName: Full=Tryptophan synthase beta ch... 77 1e-12 ref|XP_003600046.1| Tryptophan synthase beta chain [Medicago tru... 74 1e-11 dbj|BAD83779.1| tryptophan synthase beta subunit [Polygonum tinc... 73 2e-11 >emb|CBI23954.3| unnamed protein product [Vitis vinifera] Length = 407 Score = 79.0 bits (193), Expect = 4e-13 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -3 Query: 216 HALAYLDSVCPTLPNGAKVVINCSGRGDKDVHTAIKHLKV 97 HALAYL+ +CPTLPNG KVV+NCSGRGDKDVHTAIKHL+V Sbjct: 368 HALAYLEKLCPTLPNGTKVVLNCSGRGDKDVHTAIKHLQV 407 >ref|XP_002281484.1| PREDICTED: tryptophan synthase beta chain 2, chloroplastic [Vitis vinifera] Length = 458 Score = 79.0 bits (193), Expect = 4e-13 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -3 Query: 216 HALAYLDSVCPTLPNGAKVVINCSGRGDKDVHTAIKHLKV 97 HALAYL+ +CPTLPNG KVV+NCSGRGDKDVHTAIKHL+V Sbjct: 419 HALAYLEKLCPTLPNGTKVVLNCSGRGDKDVHTAIKHLQV 458 >sp|O50046.1|TRPB_CAMAC RecName: Full=Tryptophan synthase beta chain 2, chloroplastic; Flags: Precursor gi|2792520|gb|AAB97087.1| tryptophan synthase beta subunit [Camptotheca acuminata] gi|2801771|gb|AAB97526.1| tryptophan synthase beta [Camptotheca acuminata] Length = 466 Score = 77.4 bits (189), Expect = 1e-12 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = -3 Query: 216 HALAYLDSVCPTLPNGAKVVINCSGRGDKDVHTAIKHLKV 97 HALA+L+ +CPTLPNG KVV+NCSGRGDKDVHTAIKHL+V Sbjct: 427 HALAFLEKLCPTLPNGTKVVLNCSGRGDKDVHTAIKHLQV 466 >ref|XP_003600046.1| Tryptophan synthase beta chain [Medicago truncatula] gi|355489094|gb|AES70297.1| Tryptophan synthase beta chain [Medicago truncatula] Length = 412 Score = 73.9 bits (180), Expect = 1e-11 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = -3 Query: 216 HALAYLDSVCPTLPNGAKVVINCSGRGDKDVHTAIKHLKV 97 HALAYL+ +CPTLPNG KVV+NCSGRGDKDV TA+K+LK+ Sbjct: 373 HALAYLEKLCPTLPNGTKVVVNCSGRGDKDVQTAMKYLKI 412 >dbj|BAD83779.1| tryptophan synthase beta subunit [Polygonum tinctorium] Length = 474 Score = 73.2 bits (178), Expect = 2e-11 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = -3 Query: 216 HALAYLDSVCPTLPNGAKVVINCSGRGDKDVHTAIKHLKV 97 HALAYL+ +CPTL +G +VV+NCSGRGDKDVHTAIKHLK+ Sbjct: 435 HALAYLEKLCPTLADGTRVVLNCSGRGDKDVHTAIKHLKM 474