BLASTX nr result
ID: Cephaelis21_contig00011393
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00011393 (1631 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI24360.3| unnamed protein product [Vitis vinifera] 47 3e-08 emb|CAN84099.1| hypothetical protein VITISV_012062 [Vitis vinifera] 47 3e-08 ref|XP_003632257.1| PREDICTED: serrate RNA effector molecule-lik... 47 3e-08 ref|XP_002521645.1| arsenite-resistance protein, putative [Ricin... 40 3e-06 ref|XP_002529197.1| conserved hypothetical protein [Ricinus comm... 58 6e-06 >emb|CBI24360.3| unnamed protein product [Vitis vinifera] Length = 735 Score = 47.0 bits (110), Expect(2) = 3e-08 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = -1 Query: 641 DYYDRNLSPLPPPLRERDYKRG*VSPSPPPLYRDHR 534 DYYDRN S PP R+RDYKR SPSPPP YRD R Sbjct: 62 DYYDRNRSS-PPRERDRDYKRR-SSPSPPPPYRDRR 95 Score = 38.9 bits (89), Expect(2) = 3e-08 Identities = 17/25 (68%), Positives = 21/25 (84%), Gaps = 2/25 (8%) Frame = -2 Query: 487 YKRTRRDD--FDGIRGSTKGGYGPG 419 YKR+RRDD +DG RGS +GG+GPG Sbjct: 108 YKRSRRDDAGYDGRRGSPRGGFGPG 132 >emb|CAN84099.1| hypothetical protein VITISV_012062 [Vitis vinifera] Length = 194 Score = 47.0 bits (110), Expect(2) = 3e-08 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = -1 Query: 641 DYYDRNLSPLPPPLRERDYKRG*VSPSPPPLYRDHR 534 DYYDRN S PP R+RDYKR SPSPPP YRD R Sbjct: 62 DYYDRNRSS-PPRERDRDYKRR-SSPSPPPPYRDRR 95 Score = 38.9 bits (89), Expect(2) = 3e-08 Identities = 17/25 (68%), Positives = 21/25 (84%), Gaps = 2/25 (8%) Frame = -2 Query: 487 YKRTRRDD--FDGIRGSTKGGYGPG 419 YKR+RRDD +DG RGS +GG+GPG Sbjct: 108 YKRSRRDDAGYDGRRGSPRGGFGPG 132 >ref|XP_003632257.1| PREDICTED: serrate RNA effector molecule-like [Vitis vinifera] Length = 136 Score = 47.0 bits (110), Expect(2) = 3e-08 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = -1 Query: 641 DYYDRNLSPLPPPLRERDYKRG*VSPSPPPLYRDHR 534 DYYDRN S PP R+RDYKR SPSPPP YRD R Sbjct: 62 DYYDRNRSS-PPRERDRDYKRR-SSPSPPPPYRDRR 95 Score = 38.9 bits (89), Expect(2) = 3e-08 Identities = 17/25 (68%), Positives = 21/25 (84%), Gaps = 2/25 (8%) Frame = -2 Query: 487 YKRTRRDD--FDGIRGSTKGGYGPG 419 YKR+RRDD +DG RGS +GG+GPG Sbjct: 108 YKRSRRDDAGYDGRRGSPRGGFGPG 132 >ref|XP_002521645.1| arsenite-resistance protein, putative [Ricinus communis] gi|223539157|gb|EEF40752.1| arsenite-resistance protein, putative [Ricinus communis] Length = 823 Score = 40.0 bits (92), Expect(2) = 3e-06 Identities = 24/43 (55%), Positives = 29/43 (67%), Gaps = 6/43 (13%) Frame = -1 Query: 644 RDYYDRNLS-----PLPPPLRERDYKRG*VSPSPPPL-YRDHR 534 RD+Y+RN + PLPP RER+YKR S SPPP+ YRD R Sbjct: 139 RDFYERNHNHHRSPPLPPREREREYKRR-NSLSPPPIPYRDRR 180 Score = 38.9 bits (89), Expect(2) = 3e-06 Identities = 17/25 (68%), Positives = 21/25 (84%), Gaps = 2/25 (8%) Frame = -2 Query: 487 YKRTRRDD--FDGIRGSTKGGYGPG 419 YKR+RRDD +DG RGS +GG+GPG Sbjct: 191 YKRSRRDDGGYDGRRGSPRGGFGPG 215 >ref|XP_002529197.1| conserved hypothetical protein [Ricinus communis] gi|223531375|gb|EEF33211.1| conserved hypothetical protein [Ricinus communis] Length = 1088 Score = 58.2 bits (139), Expect = 6e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -3 Query: 99 SQVRGSHVGTYLPKSGIWHNTQ*FLKKGSSTLN 1 S+VRGSHVGTYLP SGIWH+TQ FL+KG+S+ N Sbjct: 267 SKVRGSHVGTYLPNSGIWHHTQRFLRKGASSTN 299