BLASTX nr result
ID: Cephaelis21_contig00011366
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00011366 (343 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511301.1| afc, putative [Ricinus communis] gi|22355041... 75 4e-24 ref|NP_001242280.1| uncharacterized protein LOC100804452 [Glycin... 75 7e-24 gb|AAC04324.1| PK12 protein kinase [Nicotiana tabacum] 75 1e-23 ref|XP_002279764.1| PREDICTED: serine/threonine-protein kinase A... 75 2e-23 emb|CAN67679.1| hypothetical protein VITISV_035275 [Vitis vinifera] 75 2e-23 >ref|XP_002511301.1| afc, putative [Ricinus communis] gi|223550416|gb|EEF51903.1| afc, putative [Ricinus communis] Length = 435 Score = 75.5 bits (184), Expect(2) = 4e-24 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 341 GRLDWPEGATSRESIKAVMKLPRLQNLVMQHVDHSA 234 GRLDWPEGATSRESIKAV+KLPRLQNLVMQHVDHSA Sbjct: 363 GRLDWPEGATSRESIKAVLKLPRLQNLVMQHVDHSA 398 Score = 60.8 bits (146), Expect(2) = 4e-24 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 129 LLQGLLRYDPSERLTAREALRHPFFTRDQYRR 34 LLQGLLRYDPS+RLTAREALRHPFF RD RR Sbjct: 404 LLQGLLRYDPSDRLTAREALRHPFFARDHLRR 435 >ref|NP_001242280.1| uncharacterized protein LOC100804452 [Glycine max] gi|255635653|gb|ACU18176.1| unknown [Glycine max] Length = 430 Score = 74.7 bits (182), Expect(2) = 7e-24 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 341 GRLDWPEGATSRESIKAVMKLPRLQNLVMQHVDHSA 234 GRLDWPEGATSRESIKAVM LPRLQNLVMQHVDHSA Sbjct: 358 GRLDWPEGATSRESIKAVMNLPRLQNLVMQHVDHSA 393 Score = 60.8 bits (146), Expect(2) = 7e-24 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 129 LLQGLLRYDPSERLTAREALRHPFFTRDQYRR 34 LLQGLLRYDPSERLTA+EALRH FF RDQ+RR Sbjct: 399 LLQGLLRYDPSERLTAKEALRHSFFMRDQFRR 430 >gb|AAC04324.1| PK12 protein kinase [Nicotiana tabacum] Length = 431 Score = 75.5 bits (184), Expect(2) = 1e-23 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 341 GRLDWPEGATSRESIKAVMKLPRLQNLVMQHVDHSA 234 GRLDWPEGATSRESIK+VMKLPRLQNLVMQHVDHSA Sbjct: 358 GRLDWPEGATSRESIKSVMKLPRLQNLVMQHVDHSA 393 Score = 59.3 bits (142), Expect(2) = 1e-23 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -2 Query: 129 LLQGLLRYDPSERLTAREALRHPFFTRDQYRR 34 LLQGLLR+DPS R+TA +ALRHPFFT+DQYRR Sbjct: 399 LLQGLLRFDPSIRMTAHDALRHPFFTKDQYRR 430 >ref|XP_002279764.1| PREDICTED: serine/threonine-protein kinase AFC2 [Vitis vinifera] gi|297733679|emb|CBI14926.3| unnamed protein product [Vitis vinifera] Length = 435 Score = 75.1 bits (183), Expect(2) = 2e-23 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 341 GRLDWPEGATSRESIKAVMKLPRLQNLVMQHVDHSA 234 GRLDWPEGATSRESIKAV+KLPRLQNL+MQHVDHSA Sbjct: 362 GRLDWPEGATSRESIKAVLKLPRLQNLIMQHVDHSA 397 Score = 58.9 bits (141), Expect(2) = 2e-23 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -2 Query: 129 LLQGLLRYDPSERLTAREALRHPFFTRDQYRRS 31 LLQGLLRYDPS+RLTA ALRHPFFTRD RRS Sbjct: 403 LLQGLLRYDPSDRLTALGALRHPFFTRDHLRRS 435 >emb|CAN67679.1| hypothetical protein VITISV_035275 [Vitis vinifera] Length = 421 Score = 75.1 bits (183), Expect(2) = 2e-23 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 341 GRLDWPEGATSRESIKAVMKLPRLQNLVMQHVDHSA 234 GRLDWPEGATSRESIKAV+KLPRLQNL+MQHVDHSA Sbjct: 348 GRLDWPEGATSRESIKAVLKLPRLQNLIMQHVDHSA 383 Score = 58.9 bits (141), Expect(2) = 2e-23 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -2 Query: 129 LLQGLLRYDPSERLTAREALRHPFFTRDQYRRS 31 LLQGLLRYDPS+RLTA ALRHPFFTRD RRS Sbjct: 389 LLQGLLRYDPSDRLTAJGALRHPFFTRDHLRRS 421