BLASTX nr result
ID: Cephaelis21_contig00011329
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00011329 (653 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|O82067.3|TOM7A_SOLTU RecName: Full=Mitochondrial import recep... 95 1e-17 ref|XP_002458194.1| hypothetical protein SORBIDRAFT_03g028510 [S... 95 1e-17 ref|XP_002523617.1| Mitochondrial import receptor subunit TOM7-1... 95 1e-17 ref|XP_004151870.1| PREDICTED: mitochondrial import receptor sub... 94 2e-17 ref|XP_003525317.1| PREDICTED: mitochondrial import receptor sub... 94 2e-17 >sp|O82067.3|TOM7A_SOLTU RecName: Full=Mitochondrial import receptor subunit TOM7-1; AltName: Full=Translocase of outer membrane 7 kDa subunit 1 gi|3319774|emb|CAA76125.1| TOM7 protein [Solanum tuberosum] Length = 72 Score = 94.7 bits (234), Expect = 1e-17 Identities = 50/73 (68%), Positives = 58/73 (79%), Gaps = 2/73 (2%) Frame = +2 Query: 122 LRPKGSKSTKNKALPLGEEDSSSKV--KLIKDWTTWTLKKAKVVTHYGFIPLIIIIGMNS 295 L+PKG K+TK KA E+D + V K +K+W TWT KKAKV+THYGFIPL+IIIGMNS Sbjct: 2 LKPKG-KNTK-KAAAADEDDGAVAVVGKFVKEWGTWTAKKAKVITHYGFIPLVIIIGMNS 59 Query: 296 EPKPSWSQLLSPV 334 EPKPS SQLLSPV Sbjct: 60 EPKPSLSQLLSPV 72 >ref|XP_002458194.1| hypothetical protein SORBIDRAFT_03g028510 [Sorghum bicolor] gi|241930169|gb|EES03314.1| hypothetical protein SORBIDRAFT_03g028510 [Sorghum bicolor] Length = 79 Score = 94.7 bits (234), Expect = 1e-17 Identities = 47/79 (59%), Positives = 59/79 (74%), Gaps = 2/79 (2%) Frame = +2 Query: 104 MSSRIALR--PKGSKSTKNKALPLGEEDSSSKVKLIKDWTTWTLKKAKVVTHYGFIPLII 277 M+SR +L+ PKG K A +++ V+L+K+WTTWT+KKAKVV HYGFIPL+I Sbjct: 1 MASRPSLKSKPKGKGGKKGGAADEDATAAATTVRLVKEWTTWTMKKAKVVAHYGFIPLVI 60 Query: 278 IIGMNSEPKPSWSQLLSPV 334 +IGMNSEPKPS QLLSPV Sbjct: 61 VIGMNSEPKPSVFQLLSPV 79 >ref|XP_002523617.1| Mitochondrial import receptor subunit TOM7-1, putative [Ricinus communis] gi|223537179|gb|EEF38812.1| Mitochondrial import receptor subunit TOM7-1, putative [Ricinus communis] Length = 75 Score = 94.7 bits (234), Expect = 1e-17 Identities = 45/77 (58%), Positives = 59/77 (76%) Frame = +2 Query: 104 MSSRIALRPKGSKSTKNKALPLGEEDSSSKVKLIKDWTTWTLKKAKVVTHYGFIPLIIII 283 M+SR++L+ KG S K EE S+ ++ +K+W+TWTLKKAKV+THYGFIPL++II Sbjct: 1 MASRVSLKSKGKSSGGAKGSKAMEEKST--IQCLKEWSTWTLKKAKVITHYGFIPLVVII 58 Query: 284 GMNSEPKPSWSQLLSPV 334 GMNSEPKP QLL+PV Sbjct: 59 GMNSEPKPQLYQLLTPV 75 >ref|XP_004151870.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Cucumis sativus] gi|449516268|ref|XP_004165169.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Cucumis sativus] Length = 73 Score = 94.4 bits (233), Expect = 2e-17 Identities = 47/77 (61%), Positives = 59/77 (76%) Frame = +2 Query: 104 MSSRIALRPKGSKSTKNKALPLGEEDSSSKVKLIKDWTTWTLKKAKVVTHYGFIPLIIII 283 M+S+++LR KG KS+K+ + + S + K+WTTW +KKAKVVTHYGFIPL+III Sbjct: 1 MASKVSLRSKG-KSSKSSSK---SSEEKSATQAFKEWTTWAVKKAKVVTHYGFIPLVIII 56 Query: 284 GMNSEPKPSWSQLLSPV 334 GMNSEPKP SQLLSPV Sbjct: 57 GMNSEPKPQLSQLLSPV 73 >ref|XP_003525317.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform 1 [Glycine max] gi|356513233|ref|XP_003525318.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform 2 [Glycine max] Length = 72 Score = 94.0 bits (232), Expect = 2e-17 Identities = 46/77 (59%), Positives = 60/77 (77%) Frame = +2 Query: 104 MSSRIALRPKGSKSTKNKALPLGEEDSSSKVKLIKDWTTWTLKKAKVVTHYGFIPLIIII 283 M+SR++L+ KG S +KA ED S+ + +K+WTTW ++KAKV+THYGFIPL+III Sbjct: 1 MASRVSLKAKGKSSKGSKAA----EDRSAS-ECLKEWTTWAMRKAKVITHYGFIPLVIII 55 Query: 284 GMNSEPKPSWSQLLSPV 334 GMNS+PKP SQLLSPV Sbjct: 56 GMNSDPKPPLSQLLSPV 72