BLASTX nr result
ID: Cephaelis21_contig00011139
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00011139 (235 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCH50976.1| T4.15 [Malus x robusta] 56 1e-06 >emb|CCH50976.1| T4.15 [Malus x robusta] Length = 986 Score = 55.8 bits (133), Expect(2) = 1e-06 Identities = 25/54 (46%), Positives = 37/54 (68%), Gaps = 2/54 (3%) Frame = -3 Query: 158 WNIE-EVENSWENVTNQMKVIAKRVLGESKSHK-WNKESWWWNQDIQEKVKAKR 3 W+ E E W+++ + ++ +AK VLGESK KESWWWN+++Q KVKAK+ Sbjct: 380 WDREGEASQMWDSMASCIRKVAKEVLGESKGFAPHQKESWWWNEEVQTKVKAKK 433 Score = 21.6 bits (44), Expect(2) = 1e-06 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 222 PKI*WWNLKNKHKRDIF 172 P+ WWNLK + K+ IF Sbjct: 355 PRTRWWNLK-EEKQAIF 370