BLASTX nr result
ID: Cephaelis21_contig00011090
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00011090 (226 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002319486.1| predicted protein [Populus trichocarpa] gi|2... 59 5e-07 gb|AFK39818.1| unknown [Medicago truncatula] 58 9e-07 ref|XP_003591211.1| Universal stress protein A-like protein [Med... 58 9e-07 ref|XP_002512499.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 gb|AFK46242.1| unknown [Lotus japonicus] 56 3e-06 >ref|XP_002319486.1| predicted protein [Populus trichocarpa] gi|222857862|gb|EEE95409.1| predicted protein [Populus trichocarpa] Length = 171 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 226 RAFLGSVSNHCAQNLKCPVLIVKMPKSQNG 137 RAFLGSVSNHCAQN+KCPVLIVK PKS +G Sbjct: 140 RAFLGSVSNHCAQNVKCPVLIVKRPKSNSG 169 >gb|AFK39818.1| unknown [Medicago truncatula] Length = 154 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 226 RAFLGSVSNHCAQNLKCPVLIVKMPKSQNG 137 RAFLGSVSNHCAQN+KCPVLIVK PKS G Sbjct: 122 RAFLGSVSNHCAQNVKCPVLIVKKPKSTTG 151 >ref|XP_003591211.1| Universal stress protein A-like protein [Medicago truncatula] gi|355480259|gb|AES61462.1| Universal stress protein A-like protein [Medicago truncatula] Length = 165 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 226 RAFLGSVSNHCAQNLKCPVLIVKMPKSQNG 137 RAFLGSVSNHCAQN+KCPVLIVK PKS G Sbjct: 133 RAFLGSVSNHCAQNVKCPVLIVKKPKSTTG 162 >ref|XP_002512499.1| conserved hypothetical protein [Ricinus communis] gi|223548460|gb|EEF49951.1| conserved hypothetical protein [Ricinus communis] Length = 173 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 226 RAFLGSVSNHCAQNLKCPVLIVKMPKSQNG 137 RAFLGSVSNHCAQN+KCPVLIVK PKS G Sbjct: 142 RAFLGSVSNHCAQNVKCPVLIVKRPKSTAG 171 >gb|AFK46242.1| unknown [Lotus japonicus] Length = 164 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 226 RAFLGSVSNHCAQNLKCPVLIVKMPKSQNGK 134 RAFLGSVSNHCAQN+KCPV+IVK PKS G+ Sbjct: 133 RAFLGSVSNHCAQNVKCPVVIVKKPKSTAGE 163