BLASTX nr result
ID: Cephaelis21_contig00011025
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00011025 (743 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631895.1| PREDICTED: transformation/transcription doma... 59 8e-07 emb|CBI17379.3| unnamed protein product [Vitis vinifera] 59 8e-07 ref|XP_002521662.1| inositol or phosphatidylinositol kinase, put... 58 2e-06 ref|NP_001190934.1| transformation/transcription domain-associat... 57 3e-06 ref|NP_001190933.1| transformation/transcription domain-associat... 57 3e-06 >ref|XP_003631895.1| PREDICTED: transformation/transcription domain-associated protein [Vitis vinifera] Length = 3906 Score = 59.3 bits (142), Expect = 8e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +1 Query: 406 EAVDQPSMDEARILLG*ILDAFVGKLNTFKSTIPQ 510 + VDQPSMDEARILLG ILDAFVGK +TFK TIPQ Sbjct: 419 KGVDQPSMDEARILLGRILDAFVGKFSTFKRTIPQ 453 >emb|CBI17379.3| unnamed protein product [Vitis vinifera] Length = 3681 Score = 59.3 bits (142), Expect = 8e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +1 Query: 406 EAVDQPSMDEARILLG*ILDAFVGKLNTFKSTIPQ 510 + VDQPSMDEARILLG ILDAFVGK +TFK TIPQ Sbjct: 388 KGVDQPSMDEARILLGRILDAFVGKFSTFKRTIPQ 422 >ref|XP_002521662.1| inositol or phosphatidylinositol kinase, putative [Ricinus communis] gi|223539053|gb|EEF40649.1| inositol or phosphatidylinositol kinase, putative [Ricinus communis] Length = 3772 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +1 Query: 406 EAVDQPSMDEARILLG*ILDAFVGKLNTFKSTIPQ 510 + +DQPSMDEAR+LLG ILDAFVGK +TFK TIPQ Sbjct: 282 KGLDQPSMDEARVLLGRILDAFVGKFSTFKRTIPQ 316 >ref|NP_001190934.1| transformation/transcription domain-associated protein [Arabidopsis thaliana] gi|332661214|gb|AEE86614.1| transformation/transcription domain-associated protein [Arabidopsis thaliana] Length = 3809 Score = 57.4 bits (137), Expect = 3e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 406 EAVDQPSMDEARILLG*ILDAFVGKLNTFKSTIPQ 510 + +DQ SMDEARILLG ILDAFVGK NTFK T+PQ Sbjct: 404 KGIDQQSMDEARILLGRILDAFVGKFNTFKRTVPQ 438 >ref|NP_001190933.1| transformation/transcription domain-associated protein [Arabidopsis thaliana] gi|332661213|gb|AEE86613.1| transformation/transcription domain-associated protein [Arabidopsis thaliana] Length = 3804 Score = 57.4 bits (137), Expect = 3e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 406 EAVDQPSMDEARILLG*ILDAFVGKLNTFKSTIPQ 510 + +DQ SMDEARILLG ILDAFVGK NTFK T+PQ Sbjct: 404 KGIDQQSMDEARILLGRILDAFVGKFNTFKRTVPQ 438