BLASTX nr result
ID: Cephaelis21_contig00010716
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00010716 (234 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525013.1| conserved hypothetical protein [Ricinus comm... 66 3e-09 ref|XP_003541396.1| PREDICTED: uncharacterized protein LOC100795... 65 4e-09 ref|XP_003536968.1| PREDICTED: uncharacterized protein LOC100800... 64 1e-08 ref|XP_002275939.2| PREDICTED: uncharacterized protein LOC100244... 61 1e-07 emb|CBI25305.3| unnamed protein product [Vitis vinifera] 61 1e-07 >ref|XP_002525013.1| conserved hypothetical protein [Ricinus communis] gi|223535675|gb|EEF37340.1| conserved hypothetical protein [Ricinus communis] Length = 670 Score = 66.2 bits (160), Expect = 3e-09 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 114 GARNFRSFKLTVKRLEEVSVSCRGVERVQLQRRWLVAL 1 GA N +SF+LTVKRLEEVSVSCRG+ERVQL RRWLVAL Sbjct: 52 GAGNSKSFRLTVKRLEEVSVSCRGIERVQLLRRWLVAL 89 >ref|XP_003541396.1| PREDICTED: uncharacterized protein LOC100795353 [Glycine max] Length = 659 Score = 65.5 bits (158), Expect = 4e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -1 Query: 111 ARNFRSFKLTVKRLEEVSVSCRGVERVQLQRRWLVAL 1 ARN +SFK TVKRLEEVSVSCRG+ERVQL RRWLVAL Sbjct: 51 ARNMQSFKHTVKRLEEVSVSCRGIERVQLLRRWLVAL 87 >ref|XP_003536968.1| PREDICTED: uncharacterized protein LOC100800057 [Glycine max] Length = 659 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -1 Query: 111 ARNFRSFKLTVKRLEEVSVSCRGVERVQLQRRWLVAL 1 ARN ++FK TVKRLEEVSVSCRG+ERVQL RRWLVAL Sbjct: 51 ARNMQNFKHTVKRLEEVSVSCRGIERVQLLRRWLVAL 87 >ref|XP_002275939.2| PREDICTED: uncharacterized protein LOC100244989 [Vitis vinifera] Length = 699 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -1 Query: 114 GARNFRSFKLTVKRLEEVSVSCRGVERVQLQRRWLVAL 1 GAR++RSF+LTVKRLEE +VSCRG ER+QL +RWL L Sbjct: 51 GARSYRSFRLTVKRLEEAAVSCRGPERIQLLKRWLAVL 88 >emb|CBI25305.3| unnamed protein product [Vitis vinifera] Length = 680 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -1 Query: 114 GARNFRSFKLTVKRLEEVSVSCRGVERVQLQRRWLVAL 1 GAR++RSF+LTVKRLEE +VSCRG ER+QL +RWL L Sbjct: 51 GARSYRSFRLTVKRLEEAAVSCRGPERIQLLKRWLAVL 88