BLASTX nr result
ID: Cephaelis21_contig00010109
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00010109 (415 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003552671.1| PREDICTED: metal tolerance protein 5-like [G... 66 3e-09 ref|NP_001242648.1| uncharacterized protein LOC100791229 [Glycin... 66 3e-09 ref|XP_002282522.2| PREDICTED: metal tolerance protein 5 isoform... 64 1e-08 ref|XP_002282508.1| PREDICTED: metal tolerance protein 5 isoform... 64 1e-08 ref|XP_004165063.1| PREDICTED: LOW QUALITY PROTEIN: metal tolera... 64 2e-08 >ref|XP_003552671.1| PREDICTED: metal tolerance protein 5-like [Glycine max] Length = 396 Score = 66.2 bits (160), Expect = 3e-09 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 3/46 (6%) Frame = -2 Query: 129 TGNVDRSWRLNFDGFQFTAEQKEKS---PRGLHDCLGVLGPEDNVS 1 + N DRSWRLNFDGFQ ++E EK PRGLHDC GVLG EDN++ Sbjct: 19 SSNGDRSWRLNFDGFQLSSEHAEKQVKPPRGLHDCYGVLGQEDNIA 64 >ref|NP_001242648.1| uncharacterized protein LOC100791229 [Glycine max] gi|255644613|gb|ACU22809.1| unknown [Glycine max] Length = 396 Score = 66.2 bits (160), Expect = 3e-09 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 3/46 (6%) Frame = -2 Query: 129 TGNVDRSWRLNFDGFQFTAEQKEKS---PRGLHDCLGVLGPEDNVS 1 + N DRSWRLNFDGFQ ++E EK PRGLHDC GVLG EDN++ Sbjct: 19 SSNGDRSWRLNFDGFQLSSEHTEKQVKPPRGLHDCYGVLGQEDNIA 64 >ref|XP_002282522.2| PREDICTED: metal tolerance protein 5 isoform 2 [Vitis vinifera] Length = 360 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 2/43 (4%) Frame = -2 Query: 123 NVDRSWRLNFDGFQFTAEQKEKSPRGLHDCLGVL--GPEDNVS 1 N DRSWRLNFDGFQ + +++K PR LHDCLGVL GPED+V+ Sbjct: 25 NGDRSWRLNFDGFQLSEHKEKKPPRSLHDCLGVLAPGPEDDVA 67 >ref|XP_002282508.1| PREDICTED: metal tolerance protein 5 isoform 1 [Vitis vinifera] gi|296086305|emb|CBI31746.3| unnamed protein product [Vitis vinifera] Length = 399 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 2/43 (4%) Frame = -2 Query: 123 NVDRSWRLNFDGFQFTAEQKEKSPRGLHDCLGVL--GPEDNVS 1 N DRSWRLNFDGFQ + +++K PR LHDCLGVL GPED+V+ Sbjct: 25 NGDRSWRLNFDGFQLSEHKEKKPPRSLHDCLGVLAPGPEDDVA 67 >ref|XP_004165063.1| PREDICTED: LOW QUALITY PROTEIN: metal tolerance protein 5-like [Cucumis sativus] Length = 395 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Frame = -2 Query: 117 DRSWRLNFDGFQFTAEQKEKSP-RGLHDCLGVLGPEDNVS 1 D SWRLNFDGFQF+ E KEK P R LHDCLGVL PED V+ Sbjct: 24 DLSWRLNFDGFQFSPEHKEKKPSRPLHDCLGVLSPEDYVA 63