BLASTX nr result
ID: Cephaelis21_contig00009473
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00009473 (1697 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW56615.1| hypothetical protein ZEAMMB73_760336 [Zea mays] 59 4e-06 gb|ACN31960.1| unknown [Zea mays] gi|413916686|gb|AFW56618.1| hy... 59 4e-06 ref|NP_001143495.1| uncharacterized protein LOC100276173 [Zea ma... 59 4e-06 gb|EEE52924.1| hypothetical protein OsJ_35544 [Oryza sativa Japo... 58 7e-06 ref|XP_002443018.1| hypothetical protein SORBIDRAFT_08g006400 [S... 58 9e-06 >gb|AFW56615.1| hypothetical protein ZEAMMB73_760336 [Zea mays] Length = 185 Score = 58.9 bits (141), Expect = 4e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -2 Query: 835 VRDAGNLLTRAGFALPGVDVDEYTVRYNSRKHLL 734 VRDAGNLLTRAGF LPGVDVD+YTVRYN+ L+ Sbjct: 67 VRDAGNLLTRAGFTLPGVDVDQYTVRYNNALELV 100 >gb|ACN31960.1| unknown [Zea mays] gi|413916686|gb|AFW56618.1| hypothetical protein ZEAMMB73_760336 [Zea mays] Length = 343 Score = 58.9 bits (141), Expect = 4e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -2 Query: 835 VRDAGNLLTRAGFALPGVDVDEYTVRYNSRKHLL 734 VRDAGNLLTRAGF LPGVDVD+YTVRYN+ L+ Sbjct: 225 VRDAGNLLTRAGFTLPGVDVDQYTVRYNNALELV 258 >ref|NP_001143495.1| uncharacterized protein LOC100276173 [Zea mays] gi|195621470|gb|ACG32565.1| hypothetical protein [Zea mays] Length = 343 Score = 58.9 bits (141), Expect = 4e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -2 Query: 835 VRDAGNLLTRAGFALPGVDVDEYTVRYNSRKHLL 734 VRDAGNLLTRAGF LPGVDVD+YTVRYN+ L+ Sbjct: 225 VRDAGNLLTRAGFTLPGVDVDQYTVRYNNALELV 258 >gb|EEE52924.1| hypothetical protein OsJ_35544 [Oryza sativa Japonica Group] Length = 348 Score = 58.2 bits (139), Expect = 7e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -2 Query: 835 VRDAGNLLTRAGFALPGVDVDEYTVRYNSRKHLL 734 VRDAGNLLTRAGF LPGVDVD YTV+YNS L+ Sbjct: 230 VRDAGNLLTRAGFTLPGVDVDRYTVKYNSALELV 263 >ref|XP_002443018.1| hypothetical protein SORBIDRAFT_08g006400 [Sorghum bicolor] gi|241943711|gb|EES16856.1| hypothetical protein SORBIDRAFT_08g006400 [Sorghum bicolor] Length = 343 Score = 57.8 bits (138), Expect = 9e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -2 Query: 835 VRDAGNLLTRAGFALPGVDVDEYTVRYNSRKHLL 734 VRDAGNLLTRAGF LPGVDVD+YTV+YN+ L+ Sbjct: 225 VRDAGNLLTRAGFTLPGVDVDQYTVKYNNALELV 258