BLASTX nr result
ID: Cephaelis21_contig00009228
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00009228 (453 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004891653.1| unnamed protein product (chloroplast) [Nicot... 56 3e-06 >ref|YP_004891653.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|351653955|ref|YP_004891682.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|11873|emb|CAA77388.1| hypothetical protein [Nicotiana tabacum] gi|1223685|emb|CAA77405.1| hypothetical protein [Nicotiana tabacum] gi|77799611|dbj|BAE46700.1| hypothetical protein [Nicotiana sylvestris] gi|77799641|dbj|BAE46730.1| hypothetical protein [Nicotiana sylvestris] gi|80750973|dbj|BAE48049.1| hypothetical protein [Nicotiana tomentosiformis] gi|80751003|dbj|BAE48079.1| hypothetical protein [Nicotiana tomentosiformis] gi|347453933|gb|AEO95591.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347453981|gb|AEO95639.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454044|gb|AEO95701.1| hypothetical protein [synthetic construct] gi|347454090|gb|AEO95747.1| hypothetical protein [synthetic construct] gi|225244|prf||1211235CC ORF 115 Length = 115 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -1 Query: 384 IDSSIFLPARNPTDKVHYIVQELATYPFSDFRTGCS 277 +++S +PARNP DKVHYIVQ LATYPFSDF TG S Sbjct: 70 LETSGKMPARNPADKVHYIVQGLATYPFSDFGTGRS 105