BLASTX nr result
ID: Cephaelis21_contig00009218
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00009218 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC49975.1| ORF; able to induce HR-like lesions [Nicotiana ta... 61 8e-08 gb|AAC49972.1| ORF; able to induce HR-like lesions [Nicotiana ta... 61 8e-08 gb|AFK36439.1| unknown [Lotus japonicus] gi|388500218|gb|AFK3817... 60 1e-07 ref|NP_001235455.1| uncharacterized protein LOC100500514 precurs... 60 2e-07 ref|NP_001237592.1| uncharacterized protein LOC100305592 precurs... 59 4e-07 >gb|AAC49975.1| ORF; able to induce HR-like lesions [Nicotiana tabacum] Length = 157 Score = 61.2 bits (147), Expect = 8e-08 Identities = 31/40 (77%), Positives = 32/40 (80%) Frame = +3 Query: 132 MALVSFLGRLLFVSVFVLAAYQEFSGFEVDGGLTAKTLRP 251 MA VSFLGR LFVSVFVL+AYQEFS F DGG AK LRP Sbjct: 1 MAFVSFLGRALFVSVFVLSAYQEFSEFGADGGPAAKALRP 40 >gb|AAC49972.1| ORF; able to induce HR-like lesions [Nicotiana tabacum] Length = 138 Score = 61.2 bits (147), Expect = 8e-08 Identities = 31/40 (77%), Positives = 32/40 (80%) Frame = +3 Query: 132 MALVSFLGRLLFVSVFVLAAYQEFSGFEVDGGLTAKTLRP 251 MA VSFLGR LFVSVFVL+AYQEFS F DGG AK LRP Sbjct: 1 MAFVSFLGRALFVSVFVLSAYQEFSEFGADGGPAAKALRP 40 >gb|AFK36439.1| unknown [Lotus japonicus] gi|388500218|gb|AFK38175.1| unknown [Lotus japonicus] Length = 156 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +3 Query: 132 MALVSFLGRLLFVSVFVLAAYQEFSGFEVDGGLTAKTLRP 251 MA +SFLGR+LF SVF+L+AYQEF+ F VDGG AK+LRP Sbjct: 1 MAFISFLGRVLFASVFILSAYQEFNEFGVDGGPAAKSLRP 40 >ref|NP_001235455.1| uncharacterized protein LOC100500514 precursor [Glycine max] gi|255630514|gb|ACU15615.1| unknown [Glycine max] Length = 157 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = +3 Query: 132 MALVSFLGRLLFVSVFVLAAYQEFSGFEVDGGLTAKTLRP 251 MA SFLGR+LF SVF+L+AYQEF+ + VDGG TAK LRP Sbjct: 1 MAFSSFLGRVLFASVFILSAYQEFNAYGVDGGPTAKALRP 40 >ref|NP_001237592.1| uncharacterized protein LOC100305592 precursor [Glycine max] gi|255626009|gb|ACU13349.1| unknown [Glycine max] Length = 156 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = +3 Query: 132 MALVSFLGRLLFVSVFVLAAYQEFSGFEVDGGLTAKTLRP 251 MA SFLGR+LF SVF+L+AYQEF+ F VDGG AK LRP Sbjct: 1 MAFASFLGRVLFASVFILSAYQEFNEFGVDGGPAAKALRP 40