BLASTX nr result
ID: Cephaelis21_contig00009012
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00009012 (263 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283752.1| PREDICTED: polypyrimidine tract-binding prot... 88 8e-16 ref|XP_002283748.1| PREDICTED: polypyrimidine tract-binding prot... 88 8e-16 gb|ABK95931.1| unknown [Populus trichocarpa] 79 4e-13 gb|ABB55397.1| polypyrimidine tract-binding protein-like [Solanu... 74 2e-11 gb|AEG89705.1| polypyrimidine tract-binding protein 7 [Solanum t... 74 2e-11 >ref|XP_002283752.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 isoform 2 [Vitis vinifera] Length = 420 Score = 87.8 bits (216), Expect = 8e-16 Identities = 46/85 (54%), Positives = 53/85 (62%) Frame = -1 Query: 263 AYSDKSRDYTVPESGLLALLQPSAIPGAETVWENSQAASLPTGSGFVAGGAAQAESSNPQ 84 A+SD+SRDYT+P+SGLLA+ Q PGA TVW+N QAA L TG A A Q Sbjct: 300 AHSDRSRDYTIPDSGLLAVQQAPGHPGATTVWQNPQAAPLYTGHDAAAAAAV-------Q 352 Query: 83 VSSWDPNIQPGRQTFVSVHSTFTGQ 9 V SWDPN+Q GR TF S S F Q Sbjct: 353 VPSWDPNMQAGRSTFASAASAFPSQ 377 >ref|XP_002283748.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 isoform 1 [Vitis vinifera] gi|296082938|emb|CBI22239.3| unnamed protein product [Vitis vinifera] Length = 449 Score = 87.8 bits (216), Expect = 8e-16 Identities = 46/85 (54%), Positives = 53/85 (62%) Frame = -1 Query: 263 AYSDKSRDYTVPESGLLALLQPSAIPGAETVWENSQAASLPTGSGFVAGGAAQAESSNPQ 84 A+SD+SRDYT+P+SGLLA+ Q PGA TVW+N QAA L TG A A Q Sbjct: 329 AHSDRSRDYTIPDSGLLAVQQAPGHPGATTVWQNPQAAPLYTGHDAAAAAAV-------Q 381 Query: 83 VSSWDPNIQPGRQTFVSVHSTFTGQ 9 V SWDPN+Q GR TF S S F Q Sbjct: 382 VPSWDPNMQAGRSTFASAASAFPSQ 406 >gb|ABK95931.1| unknown [Populus trichocarpa] Length = 473 Score = 79.0 bits (193), Expect = 4e-13 Identities = 38/87 (43%), Positives = 53/87 (60%) Frame = -1 Query: 263 AYSDKSRDYTVPESGLLALLQPSAIPGAETVWENSQAASLPTGSGFVAGGAAQAESSNPQ 84 AYSDKSRDYT+P++ L+A P + A T+W+N QA S+ TG+ + A + Q Sbjct: 329 AYSDKSRDYTIPDASLIAAQAPG-LHTAPTMWQNPQAGSMYTGNNYATTAAVPVQVPPGQ 387 Query: 83 VSSWDPNIQPGRQTFVSVHSTFTGQLY 3 V +WDP +Q G Q + SV T+ GQ Y Sbjct: 388 VPAWDPTMQAGGQGYASVPGTYPGQTY 414 >gb|ABB55397.1| polypyrimidine tract-binding protein-like [Solanum tuberosum] Length = 442 Score = 73.6 bits (179), Expect = 2e-11 Identities = 36/87 (41%), Positives = 50/87 (57%) Frame = -1 Query: 263 AYSDKSRDYTVPESGLLALLQPSAIPGAETVWENSQAASLPTGSGFVAGGAAQAESSNPQ 84 AYSDKSRDYTVPES LLA+ Q SA+ VW N Q+ + + +G+ G ++ Sbjct: 329 AYSDKSRDYTVPESSLLAMQQASAVHATPPVWHNPQSGPVQSSAGYATTGTVPGQAP--- 385 Query: 83 VSSWDPNIQPGRQTFVSVHSTFTGQLY 3 +W+PN+Q G TF S + + G Y Sbjct: 386 -PAWNPNLQGGGSTFPSAPTGYPGHSY 411 >gb|AEG89705.1| polypyrimidine tract-binding protein 7 [Solanum tuberosum] Length = 467 Score = 73.6 bits (179), Expect = 2e-11 Identities = 36/87 (41%), Positives = 50/87 (57%) Frame = -1 Query: 263 AYSDKSRDYTVPESGLLALLQPSAIPGAETVWENSQAASLPTGSGFVAGGAAQAESSNPQ 84 AYSDKSRDYTVPES LLA+ Q SA+ VW N Q+ + + +G+ G ++ Sbjct: 329 AYSDKSRDYTVPESSLLAMQQASAVHATPPVWHNPQSGPVQSSAGYATTGTVPGQAP--- 385 Query: 83 VSSWDPNIQPGRQTFVSVHSTFTGQLY 3 +W+PN+Q G TF S + + G Y Sbjct: 386 -PAWNPNLQGGGSTFPSAPTGYPGHSY 411