BLASTX nr result
ID: Cephaelis21_contig00008382
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00008382 (389 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF98466.1| cytochrome P450 [Coptis japonica var. dissecta] 65 7e-09 ref|XP_004144024.1| PREDICTED: secologanin synthase-like [Cucumi... 64 1e-08 gb|ABC69414.1| CYP72A57 [Nicotiana tabacum] 63 2e-08 gb|ABC59078.1| cytochrome P450 monooxygenase CYP72A59 [Medicago ... 62 5e-08 ref|NP_188086.1| cytochrome P450, family 72, subfamily A, polype... 62 5e-08 >dbj|BAF98466.1| cytochrome P450 [Coptis japonica var. dissecta] Length = 518 Score = 64.7 bits (156), Expect = 7e-09 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 387 MMLQKFSFELSPSYAHAPYRFITLQPQHGAQLMLHKL 277 M+LQ+FSFELS +Y HAPY ITLQPQHGAQL+LHKL Sbjct: 482 MILQRFSFELSSTYVHAPYTVITLQPQHGAQLILHKL 518 >ref|XP_004144024.1| PREDICTED: secologanin synthase-like [Cucumis sativus] gi|449500470|ref|XP_004161105.1| PREDICTED: secologanin synthase-like [Cucumis sativus] Length = 511 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -3 Query: 387 MMLQKFSFELSPSYAHAPYRFITLQPQHGAQLMLHKL 277 M+LQ FSF+LSPSYAHAP+ +TLQPQHGAQL+LH+L Sbjct: 475 MILQNFSFQLSPSYAHAPHTVMTLQPQHGAQLILHQL 511 >gb|ABC69414.1| CYP72A57 [Nicotiana tabacum] Length = 518 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -3 Query: 387 MMLQKFSFELSPSYAHAPYRFITLQPQHGAQLMLHKL 277 M+LQ+FSFELSPSYAHAP +T+QPQHGA L+LHK+ Sbjct: 482 MILQRFSFELSPSYAHAPQSILTMQPQHGAPLILHKI 518 >gb|ABC59078.1| cytochrome P450 monooxygenase CYP72A59 [Medicago truncatula] Length = 518 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -3 Query: 387 MMLQKFSFELSPSYAHAPYRFITLQPQHGAQLMLHKL 277 M+LQ+FSFELSPSYAHAP ITLQPQ+GA ++LHKL Sbjct: 480 MILQRFSFELSPSYAHAPATVITLQPQYGAHIILHKL 516 >ref|NP_188086.1| cytochrome P450, family 72, subfamily A, polypeptide 14 [Arabidopsis thaliana] gi|13605897|gb|AAK32934.1|AF367347_1 AT3g14680/MIE1_18 [Arabidopsis thaliana] gi|9294390|dbj|BAB02400.1| cytochrome P450 [Arabidopsis thaliana] gi|24111277|gb|AAN46762.1| At3g14680/MIE1_18 [Arabidopsis thaliana] gi|332642034|gb|AEE75555.1| cytochrome P450, family 72, subfamily A, polypeptide 14 [Arabidopsis thaliana] Length = 512 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -3 Query: 387 MMLQKFSFELSPSYAHAPYRFITLQPQHGAQLMLHKL 277 ++LQ+FSFELSPSY HAPY ITL PQ GA LMLHKL Sbjct: 476 LILQRFSFELSPSYVHAPYTIITLYPQFGAHLMLHKL 512