BLASTX nr result
ID: Cephaelis21_contig00008148
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00008148 (314 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002305615.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|XP_002888071.1| DNAJ heat shock N-terminal domain-containing... 54 1e-05 ref|XP_002518537.1| Cysteine string protein, putative [Ricinus c... 54 1e-05 >ref|XP_002305615.1| predicted protein [Populus trichocarpa] gi|222848579|gb|EEE86126.1| predicted protein [Populus trichocarpa] Length = 302 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/32 (75%), Positives = 31/32 (96%) Frame = +1 Query: 1 RTPAYKNKLKALELERTGGMTTRKKSNKQMNK 96 +TPAYKN+L+ALELER+GG+T +KKSNKQM+K Sbjct: 156 KTPAYKNRLRALELERSGGVTNKKKSNKQMDK 187 >ref|XP_002888071.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297333912|gb|EFH64330.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 300 Score = 54.3 bits (129), Expect = 1e-05 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +1 Query: 1 RTPAYKNKLKALELERTGGMTTRKKSNKQMNK 96 RTPAYKNKLKALELERTGG+T +KK +KQ+++ Sbjct: 154 RTPAYKNKLKALELERTGGVTNKKKGSKQIDQ 185 >ref|XP_002518537.1| Cysteine string protein, putative [Ricinus communis] gi|223542382|gb|EEF43924.1| Cysteine string protein, putative [Ricinus communis] Length = 300 Score = 54.3 bits (129), Expect = 1e-05 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +1 Query: 1 RTPAYKNKLKALELERTGGMTTRKKSNKQMNK 96 +TPAYKN+L+ALELER+GG TT+KK N+QM+K Sbjct: 154 KTPAYKNRLRALELERSGGTTTKKKGNRQMDK 185