BLASTX nr result
ID: Cephaelis21_contig00008052
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00008052 (305 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283882.1| PREDICTED: uncharacterized protein LOC100251... 56 3e-06 >ref|XP_002283882.1| PREDICTED: uncharacterized protein LOC100251040 isoform 1 [Vitis vinifera] gi|359477588|ref|XP_003632000.1| PREDICTED: uncharacterized protein LOC100251040 isoform 2 [Vitis vinifera] Length = 386 Score = 56.2 bits (134), Expect = 3e-06 Identities = 30/55 (54%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +3 Query: 144 SECGEFDLIFGEETTPSD-EPKSFLSSPVKLSGEKAKGMTPAIVTWQLPVIKPKS 305 SECGEF+LIFGEE+TP + + + SSP K SGE K + + WQ P IKPKS Sbjct: 314 SECGEFELIFGEESTPQERDHECTASSPAKFSGEGEK-IILVVSPWQPPAIKPKS 367