BLASTX nr result
ID: Cephaelis21_contig00008008
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00008008 (388 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABB55397.1| polypyrimidine tract-binding protein-like [Solanu... 69 4e-10 gb|ABB02630.1| polypyrimidine tract-binding-like [Solanum tubero... 69 4e-10 gb|AEG89705.1| polypyrimidine tract-binding protein 7 [Solanum t... 69 4e-10 ref|XP_002283752.1| PREDICTED: polypyrimidine tract-binding prot... 68 7e-10 ref|XP_002283748.1| PREDICTED: polypyrimidine tract-binding prot... 68 7e-10 >gb|ABB55397.1| polypyrimidine tract-binding protein-like [Solanum tuberosum] Length = 442 Score = 68.9 bits (167), Expect = 4e-10 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 244 RYFLPEHVNLCHLRISYSAHTDLNIKFQSHRSR*Y 140 +Y LPEHVN CHLRISYSAHTDLNIKFQSHRSR Y Sbjct: 177 KYLLPEHVNHCHLRISYSAHTDLNIKFQSHRSRDY 211 >gb|ABB02630.1| polypyrimidine tract-binding-like [Solanum tuberosum] Length = 437 Score = 68.9 bits (167), Expect = 4e-10 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 244 RYFLPEHVNLCHLRISYSAHTDLNIKFQSHRSR*Y 140 +Y LPEHVN CHLRISYSAHTDLNIKFQSHRSR Y Sbjct: 177 KYLLPEHVNHCHLRISYSAHTDLNIKFQSHRSRDY 211 >gb|AEG89705.1| polypyrimidine tract-binding protein 7 [Solanum tuberosum] Length = 467 Score = 68.9 bits (167), Expect = 4e-10 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 244 RYFLPEHVNLCHLRISYSAHTDLNIKFQSHRSR*Y 140 +Y LPEHVN CHLRISYSAHTDLNIKFQSHRSR Y Sbjct: 177 KYLLPEHVNHCHLRISYSAHTDLNIKFQSHRSRDY 211 >ref|XP_002283752.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 isoform 2 [Vitis vinifera] Length = 420 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/35 (88%), Positives = 31/35 (88%) Frame = -1 Query: 244 RYFLPEHVNLCHLRISYSAHTDLNIKFQSHRSR*Y 140 RY LPEHV CHLRISYSAHTDLNIKFQSHRSR Y Sbjct: 148 RYLLPEHVGSCHLRISYSAHTDLNIKFQSHRSRDY 182 >ref|XP_002283748.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 isoform 1 [Vitis vinifera] gi|296082938|emb|CBI22239.3| unnamed protein product [Vitis vinifera] Length = 449 Score = 68.2 bits (165), Expect = 7e-10 Identities = 31/35 (88%), Positives = 31/35 (88%) Frame = -1 Query: 244 RYFLPEHVNLCHLRISYSAHTDLNIKFQSHRSR*Y 140 RY LPEHV CHLRISYSAHTDLNIKFQSHRSR Y Sbjct: 177 RYLLPEHVGSCHLRISYSAHTDLNIKFQSHRSRDY 211