BLASTX nr result
ID: Cephaelis21_contig00006979
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00006979 (694 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002305407.1| predicted protein [Populus trichocarpa] gi|1... 100 2e-19 ref|XP_002313822.1| predicted protein [Populus trichocarpa] gi|1... 97 3e-18 ref|XP_002519115.1| conserved hypothetical protein [Ricinus comm... 97 4e-18 ref|XP_004145344.1| PREDICTED: mitochondrial import receptor sub... 96 9e-18 ref|XP_003541100.1| PREDICTED: mitochondrial import receptor sub... 92 1e-16 >ref|XP_002305407.1| predicted protein [Populus trichocarpa] gi|118484423|gb|ABK94088.1| unknown [Populus trichocarpa] gi|222848371|gb|EEE85918.1| predicted protein [Populus trichocarpa] Length = 54 Score = 100 bits (250), Expect = 2e-19 Identities = 45/54 (83%), Positives = 51/54 (94%) Frame = -1 Query: 505 MFPGMFIKKPDKAVALKQLKSHVAMFGAWVVAIRVTPYILHFFSDDKDELKLEF 344 MFPGMF++KPDKA ALKQLKSHVAMFGAWVV +RVTPY+LH+ SD+KDELKLEF Sbjct: 1 MFPGMFMRKPDKAEALKQLKSHVAMFGAWVVVLRVTPYVLHYLSDEKDELKLEF 54 >ref|XP_002313822.1| predicted protein [Populus trichocarpa] gi|118483621|gb|ABK93705.1| unknown [Populus trichocarpa] gi|222850230|gb|EEE87777.1| predicted protein [Populus trichocarpa] Length = 54 Score = 97.1 bits (240), Expect = 3e-18 Identities = 43/54 (79%), Positives = 50/54 (92%) Frame = -1 Query: 505 MFPGMFIKKPDKAVALKQLKSHVAMFGAWVVAIRVTPYILHFFSDDKDELKLEF 344 MFPG+F+KKPDKA ALKQL+SHVAMFGAWVV +RVTPY+LH+ S +KDELKLEF Sbjct: 1 MFPGLFMKKPDKAEALKQLRSHVAMFGAWVVVLRVTPYVLHYISHEKDELKLEF 54 >ref|XP_002519115.1| conserved hypothetical protein [Ricinus communis] gi|223541778|gb|EEF43326.1| conserved hypothetical protein [Ricinus communis] Length = 54 Score = 96.7 bits (239), Expect = 4e-18 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = -1 Query: 505 MFPGMFIKKPDKAVALKQLKSHVAMFGAWVVAIRVTPYILHFFSDDKDELKLEF 344 MFPGMF++KPDKA ALKQLK+H A+FGAWV IRVTPY+LH+ SDDKDELKL+F Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHAAIFGAWVALIRVTPYVLHYLSDDKDELKLDF 54 >ref|XP_004145344.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449455208|ref|XP_004145345.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474805|ref|XP_004154290.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474809|ref|XP_004154291.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532212|ref|XP_004173076.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532214|ref|XP_004173077.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] Length = 54 Score = 95.5 bits (236), Expect = 9e-18 Identities = 41/54 (75%), Positives = 49/54 (90%) Frame = -1 Query: 505 MFPGMFIKKPDKAVALKQLKSHVAMFGAWVVAIRVTPYILHFFSDDKDELKLEF 344 MFPGMF++KPDKA ALKQL+SHVAMFG WV IRVTPY+LH+ SD+K+ELKL+F Sbjct: 1 MFPGMFMRKPDKAAALKQLRSHVAMFGVWVAVIRVTPYVLHYLSDEKEELKLDF 54 >ref|XP_003541100.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform 1 [Glycine max] gi|356545339|ref|XP_003541101.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform 2 [Glycine max] gi|255626599|gb|ACU13644.1| unknown [Glycine max] Length = 54 Score = 91.7 bits (226), Expect = 1e-16 Identities = 41/53 (77%), Positives = 46/53 (86%) Frame = -1 Query: 505 MFPGMFIKKPDKAVALKQLKSHVAMFGAWVVAIRVTPYILHFFSDDKDELKLE 347 MFPGMF++KPDKA ALKQLKSH AMFG WVV IRVTPY+LHF +K+ELKLE Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHAAMFGTWVVVIRVTPYVLHFLCAEKEELKLE 53