BLASTX nr result
ID: Cephaelis21_contig00006881
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00006881 (289 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19235.3| unnamed protein product [Vitis vinifera] 81 1e-13 ref|XP_004136262.1| PREDICTED: WD and tetratricopeptide repeats ... 80 2e-13 ref|XP_002514012.1| WD and tetratricopeptide repeat protein, put... 77 2e-12 ref|XP_002873486.1| hypothetical protein ARALYDRAFT_487925 [Arab... 75 4e-12 ref|NP_001190286.1| WD and tetratricopeptide repeats protein 1 [... 75 4e-12 >emb|CBI19235.3| unnamed protein product [Vitis vinifera] Length = 762 Score = 80.9 bits (198), Expect = 1e-13 Identities = 39/49 (79%), Positives = 41/49 (83%) Frame = -3 Query: 149 LDLHCGAKKSLSDPPNQSLHLKPCDISPTKSHLLLVGGSDAFARLYYRR 3 LDL CGAKKSL+DPP Q L LK CDIS T+ HLLLVGGSDAFARLY RR Sbjct: 198 LDLRCGAKKSLADPPKQCLSLKSCDISSTRPHLLLVGGSDAFARLYDRR 246 >ref|XP_004136262.1| PREDICTED: WD and tetratricopeptide repeats protein 1-like [Cucumis sativus] gi|449497029|ref|XP_004160293.1| PREDICTED: WD and tetratricopeptide repeats protein 1-like [Cucumis sativus] Length = 759 Score = 80.1 bits (196), Expect = 2e-13 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = -3 Query: 149 LDLHCGAKKSLSDPPNQSLHLKPCDISPTKSHLLLVGGSDAFARLYYRR 3 LDL CGAK+SL+DPP Q+L LK CDIS T+ HLLLVGGSDAFARLY RR Sbjct: 198 LDLRCGAKRSLADPPRQTLALKSCDISSTRPHLLLVGGSDAFARLYDRR 246 >ref|XP_002514012.1| WD and tetratricopeptide repeat protein, putative [Ricinus communis] gi|223547098|gb|EEF48595.1| WD and tetratricopeptide repeat protein, putative [Ricinus communis] Length = 761 Score = 76.6 bits (187), Expect = 2e-12 Identities = 37/49 (75%), Positives = 40/49 (81%) Frame = -3 Query: 149 LDLHCGAKKSLSDPPNQSLHLKPCDISPTKSHLLLVGGSDAFARLYYRR 3 LDL CGAK+SL DPP Q+L LK CDIS + HLLLVGGSDAFARLY RR Sbjct: 198 LDLRCGAKRSLVDPPKQTLALKSCDISARRPHLLLVGGSDAFARLYDRR 246 >ref|XP_002873486.1| hypothetical protein ARALYDRAFT_487925 [Arabidopsis lyrata subsp. lyrata] gi|297319323|gb|EFH49745.1| hypothetical protein ARALYDRAFT_487925 [Arabidopsis lyrata subsp. lyrata] Length = 755 Score = 75.5 bits (184), Expect = 4e-12 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -3 Query: 149 LDLHCGAKKSLSDPPNQSLHLKPCDISPTKSHLLLVGGSDAFARLYYRR 3 LDL GAK++L+DPP Q+L LK CDIS T+ HLLLVGGSDAFARLY RR Sbjct: 198 LDLRSGAKRALADPPKQTLSLKSCDISATRPHLLLVGGSDAFARLYDRR 246 >ref|NP_001190286.1| WD and tetratricopeptide repeats protein 1 [Arabidopsis thaliana] gi|8979728|emb|CAB96849.1| putative protein [Arabidopsis thaliana] gi|332004229|gb|AED91612.1| WD and tetratricopeptide repeats protein 1 [Arabidopsis thaliana] Length = 754 Score = 75.5 bits (184), Expect = 4e-12 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -3 Query: 149 LDLHCGAKKSLSDPPNQSLHLKPCDISPTKSHLLLVGGSDAFARLYYRR 3 LDL GAK++L+DPP Q+L LK CDIS T+ HLLLVGGSDAFARLY RR Sbjct: 198 LDLRSGAKRALADPPKQTLSLKSCDISATRPHLLLVGGSDAFARLYDRR 246