BLASTX nr result
ID: Cephaelis21_contig00006678
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00006678 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK23173.1| unknown [Picea sitchensis] 98 8e-19 ref|XP_002510918.1| 40S ribosomal protein S13, putative [Ricinus... 97 1e-18 ref|XP_002509604.1| 40S ribosomal protein S13, putative [Ricinus... 97 1e-18 ref|XP_002280012.1| PREDICTED: 40S ribosomal protein S13 [Vitis ... 97 1e-18 ref|XP_004147576.1| PREDICTED: 40S ribosomal protein S13-like [C... 97 2e-18 >gb|ABK23173.1| unknown [Picea sitchensis] Length = 151 Score = 97.8 bits (242), Expect = 8e-19 Identities = 44/47 (93%), Positives = 47/47 (100%) Frame = -1 Query: 142 MGRMHSRGKGISASALPYKRTPPSWLKISSQDVEDNICKFAKRGMTP 2 MGRMHSRGKGIS+SALPYKRTPPSWLKISSQDVEDNICKFAK+G+TP Sbjct: 1 MGRMHSRGKGISSSALPYKRTPPSWLKISSQDVEDNICKFAKKGLTP 47 >ref|XP_002510918.1| 40S ribosomal protein S13, putative [Ricinus communis] gi|223550033|gb|EEF51520.1| 40S ribosomal protein S13, putative [Ricinus communis] Length = 112 Score = 97.4 bits (241), Expect = 1e-18 Identities = 44/47 (93%), Positives = 47/47 (100%) Frame = -1 Query: 142 MGRMHSRGKGISASALPYKRTPPSWLKISSQDVEDNICKFAKRGMTP 2 MGRMHSRGKGISASALPYKRTPPSWLKISSQDVE+NICKFAK+G+TP Sbjct: 1 MGRMHSRGKGISASALPYKRTPPSWLKISSQDVEENICKFAKKGLTP 47 >ref|XP_002509604.1| 40S ribosomal protein S13, putative [Ricinus communis] gi|223549503|gb|EEF50991.1| 40S ribosomal protein S13, putative [Ricinus communis] Length = 82 Score = 97.4 bits (241), Expect = 1e-18 Identities = 44/47 (93%), Positives = 47/47 (100%) Frame = -1 Query: 142 MGRMHSRGKGISASALPYKRTPPSWLKISSQDVEDNICKFAKRGMTP 2 MGRMHSRGKGISASALPYKRTPPSWLKISSQDVE+NICKFAK+G+TP Sbjct: 1 MGRMHSRGKGISASALPYKRTPPSWLKISSQDVEENICKFAKKGLTP 47 >ref|XP_002280012.1| PREDICTED: 40S ribosomal protein S13 [Vitis vinifera] gi|147820740|emb|CAN69640.1| hypothetical protein VITISV_028568 [Vitis vinifera] gi|296089171|emb|CBI38874.3| unnamed protein product [Vitis vinifera] Length = 151 Score = 97.4 bits (241), Expect = 1e-18 Identities = 44/47 (93%), Positives = 47/47 (100%) Frame = -1 Query: 142 MGRMHSRGKGISASALPYKRTPPSWLKISSQDVEDNICKFAKRGMTP 2 MGRMHSRGKGIS+SALPYKRTPPSWLKISSQDVE+NICKFAK+GMTP Sbjct: 1 MGRMHSRGKGISSSALPYKRTPPSWLKISSQDVEENICKFAKKGMTP 47 >ref|XP_004147576.1| PREDICTED: 40S ribosomal protein S13-like [Cucumis sativus] gi|449506113|ref|XP_004162657.1| PREDICTED: 40S ribosomal protein S13-like [Cucumis sativus] Length = 151 Score = 96.7 bits (239), Expect = 2e-18 Identities = 44/47 (93%), Positives = 46/47 (97%) Frame = -1 Query: 142 MGRMHSRGKGISASALPYKRTPPSWLKISSQDVEDNICKFAKRGMTP 2 MGRMHSRGKGISASALPYKRTPPSWLKISS DVEDNICKFAK+G+TP Sbjct: 1 MGRMHSRGKGISASALPYKRTPPSWLKISSTDVEDNICKFAKKGLTP 47