BLASTX nr result
ID: Cephaelis21_contig00006666
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00006666 (368 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275581.2| PREDICTED: pentatricopeptide repeat-containi... 73 3e-11 emb|CBI21289.3| unnamed protein product [Vitis vinifera] 73 3e-11 ref|XP_002300144.1| predicted protein [Populus trichocarpa] gi|2... 71 1e-10 ref|XP_003624481.1| Pentatricopeptide repeat-containing protein ... 70 2e-10 ref|XP_002468209.1| hypothetical protein SORBIDRAFT_01g041740 [S... 69 3e-10 >ref|XP_002275581.2| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like [Vitis vinifera] Length = 735 Score = 72.8 bits (177), Expect = 3e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +2 Query: 2 TTIRLISKIVEREIVVRDSKRFHHFRNGLCSCGDYW 109 T I+ ISKIV+REIVVRDSKRFHHFR+GLCSCGDYW Sbjct: 700 TAIKFISKIVDREIVVRDSKRFHHFRDGLCSCGDYW 735 >emb|CBI21289.3| unnamed protein product [Vitis vinifera] Length = 581 Score = 72.8 bits (177), Expect = 3e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +2 Query: 2 TTIRLISKIVEREIVVRDSKRFHHFRNGLCSCGDYW 109 T I+ ISKIV+REIVVRDSKRFHHFR+GLCSCGDYW Sbjct: 546 TAIKFISKIVDREIVVRDSKRFHHFRDGLCSCGDYW 581 >ref|XP_002300144.1| predicted protein [Populus trichocarpa] gi|222847402|gb|EEE84949.1| predicted protein [Populus trichocarpa] Length = 666 Score = 70.9 bits (172), Expect = 1e-10 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +2 Query: 2 TTIRLISKIVEREIVVRDSKRFHHFRNGLCSCGDYW 109 T I+LISKIV REI+VRD+KRFHHF++GLCSCGDYW Sbjct: 631 TVIKLISKIVSREIIVRDAKRFHHFKDGLCSCGDYW 666 >ref|XP_003624481.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|87240699|gb|ABD32557.1| Tetratricopeptide-like helical [Medicago truncatula] gi|355499496|gb|AES80699.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 672 Score = 70.1 bits (170), Expect = 2e-10 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +2 Query: 8 IRLISKIVEREIVVRDSKRFHHFRNGLCSCGDYW 109 I+LISKIV REIV+RDSKRFHHF++GLCSCGDYW Sbjct: 639 IKLISKIVNREIVIRDSKRFHHFKDGLCSCGDYW 672 >ref|XP_002468209.1| hypothetical protein SORBIDRAFT_01g041740 [Sorghum bicolor] gi|241922063|gb|EER95207.1| hypothetical protein SORBIDRAFT_01g041740 [Sorghum bicolor] Length = 635 Score = 69.3 bits (168), Expect = 3e-10 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +2 Query: 2 TTIRLISKIVEREIVVRDSKRFHHFRNGLCSCGDYW 109 TTI+LISKIV+REI+VRDS RFHHF+NG CSC DYW Sbjct: 600 TTIKLISKIVQREIIVRDSNRFHHFKNGSCSCRDYW 635