BLASTX nr result
ID: Cephaelis21_contig00006004
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00006004 (351 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN74801.1| hypothetical protein VITISV_006288 [Vitis vinifera] 65 4e-09 emb|CAA18171.1| putative protein [Arabidopsis thaliana] 64 1e-08 emb|CAB81365.1| putative protein [Arabidopsis thaliana] 64 1e-08 ref|XP_004133873.1| PREDICTED: cleavage and polyadenylation spec... 64 2e-08 gb|AFK44906.1| unknown [Medicago truncatula] 64 2e-08 >emb|CAN74801.1| hypothetical protein VITISV_006288 [Vitis vinifera] Length = 244 Score = 65.5 bits (158), Expect = 4e-09 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -2 Query: 236 VHLSEREYFAVPKNLKLLAVPLFELYDNVQV*R 138 VHLSEREYFAVPKNLKLLAVPLFELYDNVQV R Sbjct: 211 VHLSEREYFAVPKNLKLLAVPLFELYDNVQVWR 243 >emb|CAA18171.1| putative protein [Arabidopsis thaliana] Length = 210 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 236 VHLSEREYFAVPKNLKLLAVPLFELYDNVQV 144 VHLSE+EYFAVPKNLKLLAVPLFELYDNVQV Sbjct: 169 VHLSEKEYFAVPKNLKLLAVPLFELYDNVQV 199 >emb|CAB81365.1| putative protein [Arabidopsis thaliana] Length = 209 Score = 63.9 bits (154), Expect = 1e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 236 VHLSEREYFAVPKNLKLLAVPLFELYDNVQV 144 VHLSE+EYFAVPKNLKLLAVPLFELYDNVQV Sbjct: 168 VHLSEKEYFAVPKNLKLLAVPLFELYDNVQV 198 >ref|XP_004133873.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 5-like [Cucumis sativus] gi|449480168|ref|XP_004155818.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 5-like [Cucumis sativus] Length = 200 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 236 VHLSEREYFAVPKNLKLLAVPLFELYDNVQ 147 VHLSEREYFAVPKNLKLLAVPLFELYDNVQ Sbjct: 148 VHLSEREYFAVPKNLKLLAVPLFELYDNVQ 177 >gb|AFK44906.1| unknown [Medicago truncatula] Length = 200 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 236 VHLSEREYFAVPKNLKLLAVPLFELYDNVQ 147 VHLSEREYFAVPKNLKLLAVPLFELYDNVQ Sbjct: 148 VHLSEREYFAVPKNLKLLAVPLFELYDNVQ 177