BLASTX nr result
ID: Cephaelis21_contig00005915
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00005915 (447 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003617704.1| Cytochrome P450 [Medicago truncatula] gi|355... 64 1e-08 ref|XP_003634756.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P... 61 8e-08 emb|CBI39704.3| unnamed protein product [Vitis vinifera] 61 8e-08 ref|XP_003617701.1| Cytochrome P450 [Medicago truncatula] gi|355... 61 8e-08 ref|XP_003617705.1| Cytochrome P450 [Medicago truncatula] gi|355... 60 1e-07 >ref|XP_003617704.1| Cytochrome P450 [Medicago truncatula] gi|355519039|gb|AET00663.1| Cytochrome P450 [Medicago truncatula] Length = 502 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -2 Query: 446 LLYHFDWELPGKMAIEDLDMTEIFGVTVGPKHDLNLIATPYRL 318 LLYHFDW+LP M+ ++LDMTE FG+TVG KHDL LI T RL Sbjct: 460 LLYHFDWKLPNGMSHQELDMTEFFGITVGRKHDLCLIPTTRRL 502 >ref|XP_003634756.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 71D10-like [Vitis vinifera] Length = 554 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = -2 Query: 446 LLYHFDWELPGKMAIEDLDMTEIFGVTVGPKHDLNLIATPY 324 LLYHFDW+LP M EDLDMTE FG+T+ K DLNLI PY Sbjct: 508 LLYHFDWKLPDGMKHEDLDMTEEFGLTIRRKEDLNLIPIPY 548 >emb|CBI39704.3| unnamed protein product [Vitis vinifera] Length = 275 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = -2 Query: 446 LLYHFDWELPGKMAIEDLDMTEIFGVTVGPKHDLNLIATPY 324 LLYHFDW+LP M EDLDMTE FG+T+ K DLNLI PY Sbjct: 229 LLYHFDWKLPDGMKHEDLDMTEEFGLTIRRKEDLNLIPIPY 269 >ref|XP_003617701.1| Cytochrome P450 [Medicago truncatula] gi|355519036|gb|AET00660.1| Cytochrome P450 [Medicago truncatula] Length = 533 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = -2 Query: 446 LLYHFDWELPGKMAIEDLDMTEIFGVTVGPKHDLNLIATPYR 321 LLYHFDW+LP M E+LDMTE FG+T G KHDL LI P R Sbjct: 491 LLYHFDWKLPNGMKNEELDMTESFGITAGRKHDLCLIPIPRR 532 >ref|XP_003617705.1| Cytochrome P450 [Medicago truncatula] gi|355519040|gb|AET00664.1| Cytochrome P450 [Medicago truncatula] Length = 502 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = -2 Query: 446 LLYHFDWELPGKMAIEDLDMTEIFGVTVGPKHDLNLIATPYRL 318 LL HFDW+LP KM E+LDMTE FG+TVG KHDL LI RL Sbjct: 460 LLCHFDWKLPNKMKNEELDMTESFGITVGRKHDLCLIPITRRL 502