BLASTX nr result
ID: Cephaelis21_contig00005842
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00005842 (431 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFO85434.1| choline monooxygenase [Eucalyptus grandis] 70 2e-10 ref|XP_002264997.1| PREDICTED: choline monooxygenase, chloroplas... 70 2e-10 gb|ABS71853.1| choline monooxygenase [Eucalyptus camaldulensis] 70 2e-10 pir||T08550 choline monooxygenase (EC 1.1.3.-) precursor - Arabi... 69 4e-10 ref|XP_003549280.1| PREDICTED: choline monooxygenase, chloroplas... 68 7e-10 >gb|AFO85434.1| choline monooxygenase [Eucalyptus grandis] Length = 439 Score = 70.1 bits (170), Expect = 2e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = +1 Query: 265 VYCDNYLDGGYHVPYAHKGLASGLKLESYSSTV 363 V+CDNYLDGGYHVPYAHKGLASGLKL+SYS+T+ Sbjct: 260 VFCDNYLDGGYHVPYAHKGLASGLKLDSYSTTI 292 >ref|XP_002264997.1| PREDICTED: choline monooxygenase, chloroplastic [Vitis vinifera] gi|297735449|emb|CBI17889.3| unnamed protein product [Vitis vinifera] Length = 441 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 265 VYCDNYLDGGYHVPYAHKGLASGLKLESYSST 360 V+CDNYLDGGYHVPYAHKGLASGLKLESYS+T Sbjct: 276 VFCDNYLDGGYHVPYAHKGLASGLKLESYSTT 307 >gb|ABS71853.1| choline monooxygenase [Eucalyptus camaldulensis] Length = 203 Score = 70.1 bits (170), Expect = 2e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = +1 Query: 265 VYCDNYLDGGYHVPYAHKGLASGLKLESYSSTV 363 V+CDNYLDGGYHVPYAHKGLASGLKL+SYS+T+ Sbjct: 126 VFCDNYLDGGYHVPYAHKGLASGLKLDSYSTTI 158 >pir||T08550 choline monooxygenase (EC 1.1.3.-) precursor - Arabidopsis thaliana gi|4914413|emb|CAB43664.1| choline monooxygenase-like protein [Arabidopsis thaliana] gi|7269888|emb|CAB79747.1| choline monooxygenase-like protein [Arabidopsis thaliana] Length = 426 Score = 68.9 bits (167), Expect = 4e-10 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +1 Query: 265 VYCDNYLDGGYHVPYAHKGLASGLKLESYSSTVCSNC 375 V+CDNYLDGGYHVPYAHKGL SGL LE+YS+T+ ++C Sbjct: 248 VFCDNYLDGGYHVPYAHKGLMSGLDLETYSTTLVASC 284 >ref|XP_003549280.1| PREDICTED: choline monooxygenase, chloroplastic-like [Glycine max] Length = 418 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 265 VYCDNYLDGGYHVPYAHKGLASGLKLESYSSTV 363 V+CDNYLDGGYHVPYAHKGLASGLKL+SYS T+ Sbjct: 253 VFCDNYLDGGYHVPYAHKGLASGLKLDSYSITM 285