BLASTX nr result
ID: Cephaelis21_contig00005488
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00005488 (694 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003534439.1| PREDICTED: polypyrimidine tract-binding prot... 85 2e-14 dbj|BAJ99105.1| predicted protein [Hordeum vulgare subsp. vulgare] 84 3e-14 ref|XP_002533124.1| polypyrimidine tract binding protein, putati... 83 5e-14 gb|ABY75231.1| polypyrimidine tract-binding protein-like protein... 82 8e-14 ref|XP_003561590.1| PREDICTED: polypyrimidine tract-binding prot... 82 1e-13 >ref|XP_003534439.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like isoform 2 [Glycine max] Length = 505 Score = 84.7 bits (208), Expect = 2e-14 Identities = 41/53 (77%), Positives = 46/53 (86%) Frame = -2 Query: 174 VFSAFDFVHKIATFEKAAGFQALIQYSDSETASSAREELDGRSIPRHAVFWVF 16 VFSAF FVHKIATFEK AGFQALIQ++D+ETASSAR+ LDGRSIPR +VF Sbjct: 132 VFSAFGFVHKIATFEKTAGFQALIQFTDAETASSARDALDGRSIPRQVALFVF 184 >dbj|BAJ99105.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 343 Score = 84.0 bits (206), Expect = 3e-14 Identities = 44/55 (80%), Positives = 48/55 (87%) Frame = -2 Query: 198 LASAAFEQVFSAFDFVHKIATFEKAAGFQALIQYSDSETASSAREELDGRSIPRH 34 L+ AF QVFSAF FVHKIATFEKAAGFQALIQY+D TAS+ARE LDGRSIPR+ Sbjct: 2 LSPTAF-QVFSAFGFVHKIATFEKAAGFQALIQYTDPPTASAAREALDGRSIPRY 55 >ref|XP_002533124.1| polypyrimidine tract binding protein, putative [Ricinus communis] gi|223527087|gb|EEF29269.1| polypyrimidine tract binding protein, putative [Ricinus communis] Length = 483 Score = 83.2 bits (204), Expect = 5e-14 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = -2 Query: 174 VFSAFDFVHKIATFEKAAGFQALIQYSDSETASSAREELDGRSIPRHAVF 25 VFSAF FVHKIATFEKAAGFQALIQ++D+ETASSAR LDGRSIP+++ F Sbjct: 132 VFSAFGFVHKIATFEKAAGFQALIQFTDAETASSARNALDGRSIPKYSFF 181 >gb|ABY75231.1| polypyrimidine tract-binding protein-like protein [Salvia officinalis] Length = 181 Score = 82.4 bits (202), Expect = 8e-14 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = -2 Query: 174 VFSAFDFVHKIATFEKAAGFQALIQYSDSETASSAREELDGRSIPRH 34 VFSAF FVHKIATFEKAAGFQALIQYSD +TAS+AR+ LDGRSIPR+ Sbjct: 58 VFSAFGFVHKIATFEKAAGFQALIQYSDVQTASTARDSLDGRSIPRY 104 >ref|XP_003561590.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like [Brachypodium distachyon] Length = 522 Score = 82.0 bits (201), Expect = 1e-13 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = -2 Query: 174 VFSAFDFVHKIATFEKAAGFQALIQYSDSETASSAREELDGRSIPRH 34 VFSAF FVHKIATFEKAAGFQALIQY+D+ TAS+ARE LDGRSIPR+ Sbjct: 136 VFSAFGFVHKIATFEKAAGFQALIQYTDAPTASAAREALDGRSIPRY 182