BLASTX nr result
ID: Cephaelis21_contig00005171
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00005171 (642 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT40484.1| putative Myb-like DNA-binding protein [Solanum de... 60 3e-07 gb|AAT39952.2| Myb-like DNA-binding protein, putative [Solanum d... 59 8e-07 >gb|AAT40484.1| putative Myb-like DNA-binding protein [Solanum demissum] Length = 487 Score = 60.5 bits (145), Expect = 3e-07 Identities = 30/47 (63%), Positives = 33/47 (70%) Frame = -3 Query: 142 MQSVKKKLNNNTIGNSGQQQQVPKQKERHIVSWSQEEDDILREQIRI 2 MQSV KK ++G + K KERHIVSWSQEEDDILREQIRI Sbjct: 1 MQSVMKKRVTTNSSSNGNSAEAAKPKERHIVSWSQEEDDILREQIRI 47 >gb|AAT39952.2| Myb-like DNA-binding protein, putative [Solanum demissum] Length = 519 Score = 58.9 bits (141), Expect = 8e-07 Identities = 29/47 (61%), Positives = 32/47 (68%) Frame = -3 Query: 142 MQSVKKKLNNNTIGNSGQQQQVPKQKERHIVSWSQEEDDILREQIRI 2 MQS KK ++G + K KERHIVSWSQEEDDILREQIRI Sbjct: 1 MQSAMKKRVTTNSSSNGNSAEAAKPKERHIVSWSQEEDDILREQIRI 47