BLASTX nr result
ID: Cephaelis21_contig00005069
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00005069 (2210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003543999.1| PREDICTED: UPF0586 protein C9orf41 homolog [... 58 9e-06 >ref|XP_003543999.1| PREDICTED: UPF0586 protein C9orf41 homolog [Glycine max] Length = 456 Score = 58.2 bits (139), Expect = 9e-06 Identities = 30/58 (51%), Positives = 40/58 (68%) Frame = +1 Query: 409 SLKVKSLWRIISAYLNYPKAVEKDVRRNERSFESLLIAHKVQFLWHFMGF*LLCFCVS 582 +L+++SL RIISAYLNYP A E+DVRRNERS+ L +HK + F L +C+S Sbjct: 17 ALEIQSLRRIISAYLNYPDAAEEDVRRNERSYRKLPPSHKALLSQYPQKFQRLRWCIS 74