BLASTX nr result
ID: Cephaelis21_contig00004873
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00004873 (495 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534235.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002534235.1| conserved hypothetical protein [Ricinus communis] gi|223525663|gb|EEF28149.1| conserved hypothetical protein [Ricinus communis] Length = 763 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = -3 Query: 106 MWRSLWGSTDRYSVQRFRYIINELREIKFVDIRNR 2 MWRSLW S DR+S+Q F+++INELREIK VD NR Sbjct: 1 MWRSLWRSIDRFSLQHFKHVINELREIKVVDKHNR 35