BLASTX nr result
ID: Cephaelis21_contig00004627
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00004627 (346 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAE48658.1| Cinnamyl alcohol dehydrogenase [Prunus mume] 60 2e-07 gb|AFY97683.1| cinnamyl alcohol dehydrogenase 1 [Pyrus pyrifolia] 60 2e-07 ref|XP_002268322.1| PREDICTED: bifunctional dihydroflavonol 4-re... 59 4e-07 ref|XP_002268122.1| PREDICTED: bifunctional dihydroflavonol 4-re... 59 4e-07 gb|AAC06319.1| putative cinnamyl alcohol dehydrogenase [Malus x ... 59 5e-07 >dbj|BAE48658.1| Cinnamyl alcohol dehydrogenase [Prunus mume] Length = 325 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 2 PDYKVSNDKAKSLGIEFIPSEVSLKDTIDSLKEKNFV 112 P Y+VS +KAK LG+EFIP EVSLK+T++SLKEKNFV Sbjct: 287 PTYQVSKEKAKKLGVEFIPLEVSLKETVESLKEKNFV 323 >gb|AFY97683.1| cinnamyl alcohol dehydrogenase 1 [Pyrus pyrifolia] Length = 325 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = +2 Query: 2 PDYKVSNDKAKSLGIEFIPSEVSLKDTIDSLKEKNFVS 115 P Y+VS +KAKSLG+EFIP +VSLK+T++SLKEK FVS Sbjct: 287 PTYQVSKEKAKSLGVEFIPLDVSLKETVESLKEKGFVS 324 >ref|XP_002268322.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [Vitis vinifera] gi|298205076|emb|CBI40597.3| unnamed protein product [Vitis vinifera] Length = 326 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = +2 Query: 2 PDYKVSNDKAKSLGIEFIPSEVSLKDTIDSLKEKNFVS 115 P ++VS +KAKSLGI F P EVS+KDT++SLKEKNF+S Sbjct: 288 PTFRVSQEKAKSLGIHFTPLEVSIKDTVESLKEKNFIS 325 >ref|XP_002268122.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [Vitis vinifera] gi|298205080|emb|CBI40601.3| unnamed protein product [Vitis vinifera] Length = 326 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = +2 Query: 2 PDYKVSNDKAKSLGIEFIPSEVSLKDTIDSLKEKNFVS 115 P ++VS +KAKSLGI F P EVS+KDT++SLKEKNF+S Sbjct: 288 PTFRVSQEKAKSLGIHFTPLEVSMKDTVESLKEKNFIS 325 >gb|AAC06319.1| putative cinnamyl alcohol dehydrogenase [Malus x domestica] Length = 325 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/38 (68%), Positives = 34/38 (89%) Frame = +2 Query: 2 PDYKVSNDKAKSLGIEFIPSEVSLKDTIDSLKEKNFVS 115 P Y+VS +KAKSLG+EFIP +VSLK+T++SLKEK FV+ Sbjct: 287 PTYQVSKEKAKSLGVEFIPLDVSLKETVESLKEKGFVN 324